C20orf103 (LAMP5) (NM_012261) Human Recombinant Protein

BAD-LAMP/LAMP5 protein,

Recombinant protein of human chromosome 20 open reading frame 103 (C20orf103)

Product Info Summary

SKU: PROTQ9UJQ1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C20orf103 (LAMP5) (NM_012261) Human Recombinant Protein

View all BAD-LAMP/LAMP5 recombinant proteins

SKU/Catalog Number

PROTQ9UJQ1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 20 open reading frame 103 (C20orf103)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C20orf103 (LAMP5) (NM_012261) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UJQ1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.1 kDa

Amino Acid Sequence

MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMG

Validation Images & Assay Conditions

Gene/Protein Information For LAMP5 (Source: Uniprot.org, NCBI)

Gene Name

LAMP5

Full Name

Lysosome-associated membrane glycoprotein 5

Weight

28.1 kDa

Superfamily

LAMP family

Alternative Names

BADLAMP; BAD-LAMP; C20orf103; chromosome 20 open reading frame 103; dJ1119D9.3; LAMP family protein C20orf103; LAMP5; LAMP-5; lysosomal-associated membrane protein family, member 5; UNC-43 LAMP5 BAD-LAMP, BADLAMP, C20orf103, LAMP-5, UNC-46 lysosomal associated membrane protein family member 5 lysosome-associated membrane glycoprotein 5|LAMP family protein C20orf103|brain and dendritic cell-associated LAMP|brain-associated LAMP-like protein|lysosome-associated membrane protein 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LAMP5, check out the LAMP5 Infographic

LAMP5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LAMP5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UJQ1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C20orf103 (LAMP5) (NM_012261) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C20orf103 (LAMP5) (NM_012261) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C20orf103 (LAMP5) (NM_012261) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UJQ1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.