C1orf149 (MEAF6) (NM_022756) Human Recombinant Protein

Eaf6 protein,

Recombinant protein of human chromosome 1 open reading frame 149 (C1orf149)

Product Info Summary

SKU: PROTQ9HAF1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C1orf149 (MEAF6) (NM_022756) Human Recombinant Protein

View all Eaf6 recombinant proteins

SKU/Catalog Number

PROTQ9HAF1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 1 open reading frame 149 (C1orf149)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C1orf149 (MEAF6) (NM_022756) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HAF1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.6 kDa

Amino Acid Sequence

MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHSPSGMFDYDFEIDLKLNKKPRADY

Validation Images & Assay Conditions

Gene/Protein Information For MEAF6 (Source: Uniprot.org, NCBI)

Gene Name

MEAF6

Full Name

Chromatin modification-related protein MEAF6

Weight

22.6 kDa

Superfamily

EAF6 family

Alternative Names

CENP-28; centromere protein 28; chromatin modification-related protein MEAF6; MYST/Esa1-associated factor 6; NY-SAR-91; sarcoma antigen NY-SAR-91 MEAF6 C1orf149, CENP-28, EAF6, NY-SAR-91 MYST/Esa1 associated factor 6 chromatin modification-related protein MEAF6|Esa1p-associated factor 6 homolog|centromere protein 28|protein EAF6 homolog|sarcoma NY-SAR-91

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MEAF6, check out the MEAF6 Infographic

MEAF6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MEAF6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9HAF1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C1orf149 (MEAF6) (NM_022756) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C1orf149 (MEAF6) (NM_022756) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C1orf149 (MEAF6) (NM_022756) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HAF1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.