C1D (NM_006333) Human Recombinant Protein

C1D protein,

Product Info Summary

SKU: PROTQ13901
Size: 20 µg
Source: HEK293T

Product Name

C1D (NM_006333) Human Recombinant Protein

View all C1D recombinant proteins

SKU/Catalog Number

PROTQ13901

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C1D (NM_006333) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13901)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.8 kDa

Amino Acid Sequence

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS

Validation Images & Assay Conditions

Gene/Protein Information For C1D (Source: Uniprot.org, NCBI)

Gene Name

C1D

Full Name

Nuclear nucleic acid-binding protein C1D

Weight

15.8 kDa

Superfamily

C1D family

Alternative Names

C1D DNA-binding protein; C1D nuclear receptor corepressor; C1D nuclear receptor co-repressor; C1D; hC1D; MGC12261; MGC14659; nuclear DNA-binding protein; nuclear nucleic acid-binding protein C1D; small unique nuclear receptor corepressor; small unique nuclear receptor co-repressor; SUNCOR; SUN-CoR; SUNCORLRP1 C1D LRP1, Rrp47, SUN-CoR, SUNCOR, hC1D C1D nuclear receptor corepressor nuclear nucleic acid-binding protein C1D|C1D DNA-binding protein|C1D nuclear receptor co-repressor|nuclear DNA-binding protein|small unique nuclear receptor co-repressor|small unique nuclear receptor corepressor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on C1D, check out the C1D Infographic

C1D infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for C1D: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13901

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C1D (NM_006333) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C1D (NM_006333) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C1D (NM_006333) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13901
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.