C19orf63 (EMC10) (NM_175063) Human Recombinant Protein

ER Membrane Protein Complex Subunit 10 protein,

Recombinant protein of human chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1

Product Info Summary

SKU: PROTQ5UCC4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C19orf63 (EMC10) (NM_175063) Human Recombinant Protein

View all ER Membrane Protein Complex Subunit 10 recombinant proteins

SKU/Catalog Number

PROTQ5UCC4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C19orf63 (EMC10) (NM_175063) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5UCC4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.6 kDa

Amino Acid Sequence

MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEA

Validation Images & Assay Conditions

Gene/Protein Information For EMC10 (Source: Uniprot.org, NCBI)

Gene Name

EMC10

Full Name

ER membrane protein complex subunit 10

Weight

26.6 kDa

Superfamily

EMC10 family

Alternative Names

C19orf63; Chromosome 19 Open Reading Frame 63; EMC10; Hematopoietic Signal Peptide-Containing Membrane Domain-Containing 1; Hematopoietic Signal Peptide-Containing Membrane Domain-Containing Protein 1; Hematopoietic Signal Peptide-Containing Secreted 1; HSM1; HSS1; INM02; UPF0510 Protein INM02 Emc10|2310044H10Rik, 5430410O10Rik, Inm02, Mirt, Mirta22|ER membrane protein complex subunit 10|ER membrane protein complex subunit 10|UPF0510 protein INM02|hematopoietic signal peptide-containing membrane domain-containing protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EMC10, check out the EMC10 Infographic

EMC10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EMC10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5UCC4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C19orf63 (EMC10) (NM_175063) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C19orf63 (EMC10) (NM_175063) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C19orf63 (EMC10) (NM_175063) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5UCC4
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.