C12orf69 (SMCO3) (NM_001013698) Human Recombinant Protein

SMCO3 protein,

Recombinant protein of human chromosome 12 open reading frame 69 (C12orf69)

Product Info Summary

SKU: PROTA2RU48
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C12orf69 (SMCO3) (NM_001013698) Human Recombinant Protein

View all SMCO3 recombinant proteins

SKU/Catalog Number

PROTA2RU48

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 12 open reading frame 69 (C12orf69)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C12orf69 (SMCO3) (NM_001013698) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA2RU48)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.7 kDa

Amino Acid Sequence

MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINSETPNEMNSRFICH

Validation Images & Assay Conditions

Gene/Protein Information For SMCO3 (Source: Uniprot.org, NCBI)

Gene Name

SMCO3

Full Name

Single-pass membrane and coiled-coil domain-containing protein 3

Weight

24.7 kDa

Alternative Names

Single-pass membrane and coiled-coil domain-containing protein 3 SMCO3 C12orf69 single-pass membrane protein with coiled-coil domains 3 single-pass membrane and coiled-coil domain-containing protein 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SMCO3, check out the SMCO3 Infographic

SMCO3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SMCO3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA2RU48

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C12orf69 (SMCO3) (NM_001013698) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C12orf69 (SMCO3) (NM_001013698) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C12orf69 (SMCO3) (NM_001013698) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA2RU48
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.