C12orf23 (TMEM263) (NM_152261) Human Recombinant Protein

TMEM263 protein,

Recombinant protein of human chromosome 12 open reading frame 23 (C12orf23)

Product Info Summary

SKU: PROTQ8WUH6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C12orf23 (TMEM263) (NM_152261) Human Recombinant Protein

View all TMEM263 recombinant proteins

SKU/Catalog Number

PROTQ8WUH6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 12 open reading frame 23 (C12orf23)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C12orf23 (TMEM263) (NM_152261) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WUH6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.6 kDa

Amino Acid Sequence

MNQTDKNQQEIPSYLNDEPPEGSMKDHPQQQPGMLSRVTGGIFSVTKGAVGATIGGVAWIGGKSLEVTKTAVTTVPSMGIGLVKGGVSAVAGGVTAVGSAVVNKVPLTGKKKDKSD

Validation Images & Assay Conditions

Gene/Protein Information For TMEM263 (Source: Uniprot.org, NCBI)

Gene Name

TMEM263

Full Name

Transmembrane protein 263

Weight

11.6 kDa

Superfamily

TMEM263 family

Alternative Names

Transmembrane protein 263 TMEM263 C12orf23 transmembrane protein 263 transmembrane protein 263|UPF0444 transmembrane protein C12orf23

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMEM263, check out the TMEM263 Infographic

TMEM263 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMEM263: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WUH6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C12orf23 (TMEM263) (NM_152261) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C12orf23 (TMEM263) (NM_152261) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C12orf23 (TMEM263) (NM_152261) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WUH6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product