C11ORF77 (HARBI1) (NM_173811) Human Recombinant Protein

Harbi1 protein,

Recombinant protein of human harbinger transposase derived 1 (HARBI1)

Product Info Summary

SKU: PROTQ96MB7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C11ORF77 (HARBI1) (NM_173811) Human Recombinant Protein

View all Harbi1 recombinant proteins

SKU/Catalog Number

PROTQ96MB7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human harbinger transposase derived 1 (HARBI1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C11ORF77 (HARBI1) (NM_173811) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96MB7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39 kDa

Amino Acid Sequence

MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS

Validation Images & Assay Conditions

Gene/Protein Information For HARBI1 (Source: Uniprot.org, NCBI)

Gene Name

HARBI1

Full Name

Putative nuclease HARBI1

Weight

39 kDa

Superfamily

HARBI1 family

Alternative Names

C11orf77; chromosome 11 open reading frame 77; EC 3.1; FLJ32675; harbinger transposase derived 1; Harbinger transposase-derived nuclease; putative nuclease HARBI1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HARBI1, check out the HARBI1 Infographic

HARBI1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HARBI1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96MB7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C11ORF77 (HARBI1) (NM_173811) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C11ORF77 (HARBI1) (NM_173811) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C11ORF77 (HARBI1) (NM_173811) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96MB7
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.