C11orf20 (TEX40) (NM_001039496) Human Recombinant Protein

CATSPERZ protein,

Recombinant protein of human chromosome 11 open reading frame 20 (C11orf20)

Product Info Summary

SKU: PROTQ9NTU4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C11orf20 (TEX40) (NM_001039496) Human Recombinant Protein

View all CATSPERZ recombinant proteins

SKU/Catalog Number

PROTQ9NTU4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 11 open reading frame 20 (C11orf20)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C11orf20 (TEX40) (NM_001039496) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NTU4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.7 kDa

Amino Acid Sequence

MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN

Validation Images & Assay Conditions

Gene/Protein Information For CATSPERZ (Source: Uniprot.org, NCBI)

Gene Name

CATSPERZ

Full Name

Cation channel sperm-associated protein subunit zeta

Weight

22.7 kDa

Alternative Names

Cation channel sperm-associated protein subunit zeta CATSPERZ C11orf20, TEX40 catsper channel auxiliary subunit zeta cation channel sperm-associated protein subunit zeta|catSper-zeta|catSperzeta|testis expressed 40|testis-expressed protein 40|testis-expressed sequence 40 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CATSPERZ, check out the CATSPERZ Infographic

CATSPERZ infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CATSPERZ: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NTU4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C11orf20 (TEX40) (NM_001039496) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C11orf20 (TEX40) (NM_001039496) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C11orf20 (TEX40) (NM_001039496) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NTU4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.