BOP1 (NM_015201) Human Recombinant Protein

Bop1 protein,

Recombinant protein of human block of proliferation 1 (BOP1)

Product Info Summary

SKU: PROTQ14137
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

BOP1 (NM_015201) Human Recombinant Protein

View all Bop1 recombinant proteins

SKU/Catalog Number

PROTQ14137

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human block of proliferation 1 (BOP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BOP1 (NM_015201) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14137)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

83.4 kDa

Amino Acid Sequence

MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGDEYAEDSSDEEDIRNTVGNVPLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEPAVDFFSGDVMIHPVTNRPADKRSFIPSLVEKEKVSRMVHAIKMGWIQPRRPRDPTPSFYDLWAQEDPNAVLGRHKMHVPAPKLALPGHAESYNPPPEYLLSEEERLAWEQQEPGERKLSFLPRKFPSLRAVPAYGRFIQERFERCLDLYLCPRQRKMRVNVDPEDLIPKLPRPRDLQPFPTCQALVYRGHSDLVRCLSVSPGGQWLVSGSDDGSLRLWEVATARCVRTVPVGGVVKSVAWNPSPAVCLVAAAVEDSVLLLNPALGDRLVAGSTDQLLSAFVPPEEPPLQPARWLEASEEERQVGLRLRICHGKPVTQVTWHGRGDYLAVVLATQGHTQVLIHQLSRRRSQSPFRRSHGQVQRVAFHPARPFLLVASQRSVRLYHLLRQELTKKLMPNCKWVSSLAVHPAGDNVICGSYDSKLVWFDLDLSTKPYRMLRHHKKALRAVAFHPRYPLFASGSDDGSVIVCHGMVYNDLLQNPLLVPVKVLKGHVLTRDLGVLDVIFHPTQPWVFSSGADGTVRLFT

Validation Images & Assay Conditions

Gene/Protein Information For BOP1 (Source: Uniprot.org, NCBI)

Gene Name

BOP1

Full Name

Ribosome biogenesis protein BOP1

Weight

83.4 kDa

Superfamily

WD repeat BOP1/ERB1 family

Alternative Names

block of proliferation 1; KIAA0124Block of proliferation 1 protein; ribosome biogenesis protein BOP1 Bop1|AU020183, AW146150, D18861, Erb, Erb1p, Kiaa0124, mKIAA0124|block of proliferation 1|ribosome biogenesis protein BOP1|block of proliferation 1 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BOP1, check out the BOP1 Infographic

BOP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BOP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14137

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BOP1 (NM_015201) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BOP1 (NM_015201) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BOP1 (NM_015201) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14137
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.