BOLA1 (NM_016074) Human Recombinant Protein

BOLA1 protein,

Product Info Summary

SKU: PROTQ9Y3E2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

BOLA1 (NM_016074) Human Recombinant Protein

View all BOLA1 recombinant proteins

SKU/Catalog Number

PROTQ9Y3E2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human bolA homolog 1 (E. coli) (BOLA1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BOLA1 (NM_016074) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y3E2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.1 kDa

Amino Acid Sequence

MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

Validation Images & Assay Conditions

Gene/Protein Information For BOLA1 (Source: Uniprot.org, NCBI)

Gene Name

BOLA1

Full Name

BolA-like protein 1

Weight

14.1 kDa

Superfamily

BolA/IbaG family

Alternative Names

bolA homolog 1 (E. coli); bolA-like 1 (E. coli); bolA-like 1; bolA-like protein 1; CGI-143; hBolA; MGC75015; RP11-196G18.18 BOLA1 CGI-143 bolA family member 1 bolA-like protein 1|bolA homolog 1|bolA-like 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BOLA1, check out the BOLA1 Infographic

BOLA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BOLA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y3E2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BOLA1 (NM_016074) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BOLA1 (NM_016074) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BOLA1 (NM_016074) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y3E2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.