BLU (ZMYND10) (NM_015896) Human Recombinant Protein

BLU protein,

Recombinant protein of human zinc finger, MYND-type containing 10 (ZMYND10)

Product Info Summary

SKU: PROTO75800
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

BLU (ZMYND10) (NM_015896) Human Recombinant Protein

View all BLU recombinant proteins

SKU/Catalog Number

PROTO75800

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc finger, MYND-type containing 10 (ZMYND10)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BLU (ZMYND10) (NM_015896) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75800)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

50.2 kDa

Amino Acid Sequence

MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYCLTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQAIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAK

Validation Images & Assay Conditions

Gene/Protein Information For ZMYND10 (Source: Uniprot.org, NCBI)

Gene Name

ZMYND10

Full Name

Zinc finger MYND domain-containing protein 10

Weight

50.2 kDa

Superfamily

ZMYND10 family

Alternative Names

FLU; MYND domain containing 10; zinc finger, MYND-type containing 10 ZMYND10 BLU, CILD22, DNAAF7, FLU zinc finger MYND-type containing 10 zinc finger MYND domain-containing protein 10|dynein axonemal assembly factor 7|protein BLu

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZMYND10, check out the ZMYND10 Infographic

ZMYND10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZMYND10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75800

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BLU (ZMYND10) (NM_015896) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BLU (ZMYND10) (NM_015896) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BLU (ZMYND10) (NM_015896) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75800
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.