BCL7B (NM_001197244) Human Recombinant Protein

BCL7B protein,

Purified recombinant protein of Homo sapiens B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2.

Product Info Summary

SKU: PROTQ9BQE9
Size: 20 µg
Source: HEK293T

Product Name

BCL7B (NM_001197244) Human Recombinant Protein

View all BCL7B recombinant proteins

SKU/Catalog Number

PROTQ9BQE9

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BCL7B (NM_001197244) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BQE9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.0165kDa

Amino Acid Sequence

MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES

Validation Images & Assay Conditions

Gene/Protein Information For BCL7B (Source: Uniprot.org, NCBI)

Gene Name

BCL7B

Full Name

B-cell CLL/lymphoma 7 protein family member B

Weight

0.0165kDa

Superfamily

BCL7 family

Alternative Names

Allergen Hom s 3; B-cell CLL/lymphoma 7 protein family member B; B-cell CLL/lymphoma 7B BCL7B BAF chromatin remodeling complex subunit BCL7B B-cell CLL/lymphoma 7 protein family member B|B-cell CLL/lymphoma 7B|BCL tumor suppressor 7B|BCL7B, BAF complex component

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BCL7B, check out the BCL7B Infographic

BCL7B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BCL7B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used BCL7B (NM_001197244) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BCL7B (NM_001197244) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BCL7B (NM_001197244) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BQE9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.