SNRPD2 (NM_004597) Human Recombinant Protein

SNRPD2 protein,

Product Info Summary

SKU: PROTP62316
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SNRPD2 (NM_004597) Human Recombinant Protein

View all SNRPD2 recombinant proteins

SKU/Catalog Number

PROTP62316

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SNRPD2 (NM_004597) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP62316)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.3 kDa

Amino Acid Sequence

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Validation Images & Assay Conditions

Gene/Protein Information For SNRPD2 (Source: Uniprot.org, NCBI)

Gene Name

SNRPD2

Full Name

Small nuclear ribonucleoprotein Sm D2

Weight

13.3 kDa

Superfamily

snRNP core protein family

Alternative Names

small nuclear ribonucleoprotein D2 polypeptide (16.5kD); small nuclear ribonucleoprotein D2 polypeptide 16.5kDa; small nuclear ribonucleoprotein Sm D2; Sm-D2SMD2; snRNP core protein D2; SNRPD1 SNRPD2 SMD2, SNRPD1, Sm-D2 small nuclear ribonucleoprotein D2 polypeptide small nuclear ribonucleoprotein Sm D2|small nuclear ribonucleoprotein D2 polypeptide 16.5kDa|snRNP core protein D2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SNRPD2, check out the SNRPD2 Infographic

SNRPD2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SNRPD2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP62316

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SNRPD2 (NM_004597) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SNRPD2 (NM_004597) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SNRPD2 (NM_004597) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP62316
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.