Bcl 7A (BCL7A) (NM_001024808) Human Recombinant Protein

Bcl 7A protein,

Product Info Summary

SKU: PROTQ4VC05
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Bcl 7A (BCL7A) (NM_001024808) Human Recombinant Protein

View all Bcl 7A recombinant proteins

SKU/Catalog Number

PROTQ4VC05

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human B-cell CLL/lymphoma 7A (BCL7A), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Bcl 7A (BCL7A) (NM_001024808) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ4VC05)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.6 kDa

Amino Acid Sequence

MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM

Validation Images & Assay Conditions

Gene/Protein Information For BCL7A (Source: Uniprot.org, NCBI)

Gene Name

BCL7A

Full Name

B-cell CLL/lymphoma 7 protein family member A

Weight

22.6 kDa

Superfamily

BCL7 family

Alternative Names

B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma 7A; B-cell CLL/lymphoma-7; BCL7 BCL7A BCL7 BAF chromatin remodeling complex subunit BCL7A B-cell CLL/lymphoma 7 protein family member A|B-cell CLL/lymphoma 7A|B-cell CLL/lymphoma-7|BCL tumor suppressor 7A|BCL7A, BAF complex component

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BCL7A, check out the BCL7A Infographic

BCL7A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BCL7A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ4VC05

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Bcl 7A (BCL7A) (NM_001024808) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Bcl 7A (BCL7A) (NM_001024808) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Bcl 7A (BCL7A) (NM_001024808) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ4VC05
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.