BBOX1 (NM_003986) Human Recombinant Protein

BBOX1 protein,

Recombinant protein of human butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 (BBOX1)

Product Info Summary

SKU: PROTO75936
Size: 20 µg
Source: HEK293T

Product Name

BBOX1 (NM_003986) Human Recombinant Protein

View all BBOX1 recombinant proteins

SKU/Catalog Number

PROTO75936

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 (BBOX1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BBOX1 (NM_003986) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75936)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

44.5 kDa

Amino Acid Sequence

MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN

Validation Images & Assay Conditions

Gene/Protein Information For BBOX1 (Source: Uniprot.org, NCBI)

Gene Name

BBOX1

Full Name

Gamma-butyrobetaine dioxygenase

Weight

44.5 kDa

Superfamily

gamma-BBH/TMLD family

Alternative Names

2-oxoglutarate dioxygenase 1; 2-oxoglutarate dioxygenase; BBHgamma-butyrobetaine; BBOXEC 1.14.11.1; butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetainehydroxylase) 1; Gamma-BBH; gamma-butyrobetaine dioxygenase; Gamma-butyrobetaine hydroxylase; Gamma-butyrobetaine; G-BBH BBOX1 BBH, BBOX, G-BBH, gamma-BBH gamma-butyrobetaine hydroxylase 1 gamma-butyrobetaine dioxygenase|butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1|gamma-butyrobetaine,2-oxoglutarate dioxygenase 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BBOX1, check out the BBOX1 Infographic

BBOX1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BBOX1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75936

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BBOX1 (NM_003986) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BBOX1 (NM_003986) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BBOX1 (NM_003986) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75936
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.