BAP31 (BCAP31) (NM_005745) Human Recombinant Protein

BCAP31 protein,

Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 2

Product Info Summary

SKU: PROTP51572
Size: 20 µg
Source: HEK293T

Product Name

BAP31 (BCAP31) (NM_005745) Human Recombinant Protein

View all BCAP31 recombinant proteins

SKU/Catalog Number

PROTP51572

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BAP31 (BCAP31) (NM_005745) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP51572)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.8 kDa

Amino Acid Sequence

MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Validation Images & Assay Conditions

Gene/Protein Information For BCAP31 (Source: Uniprot.org, NCBI)

Gene Name

BCAP31

Full Name

B-cell receptor-associated protein 31

Weight

27.8 kDa

Superfamily

BCAP29/BCAP31 family

Alternative Names

6C6-Ag; BAP31; Bap31,6C6-AG; BAP31DXS1357ECDM; BCAP31; B-cell receptor-associated protein 31; BCR-associated protein 31; BCR-associated protein Bap31,6C6-AG tumor-associated antigen; p28 Bap31,6C6-Ag; p28; Protein CDM BCAP31 6C6-AG, BAP31, CDM, DDCH, DXS1357E B cell receptor associated protein 31 B-cell receptor-associated protein 31|6C6-AG tumor-associated antigen|BCR-associated protein Bap31|p28 Bap31

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BCAP31, check out the BCAP31 Infographic

BCAP31 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BCAP31: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP51572

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BAP31 (BCAP31) (NM_005745) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BAP31 (BCAP31) (NM_005745) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BAP31 (BCAP31) (NM_005745) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP51572
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.