BAIAP2 (NM_006340) Human Recombinant Protein

BAIAP2 protein,

Product Info Summary

SKU: PROTQ9UQB8
Size: 20 µg
Source: HEK293T

Product Name

BAIAP2 (NM_006340) Human Recombinant Protein

View all BAIAP2 recombinant proteins

SKU/Catalog Number

PROTQ9UQB8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BAIAP2 (NM_006340) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UQB8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

57.3 kDa

Amino Acid Sequence

MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSSADVEVARF

Validation Images & Assay Conditions

Gene/Protein Information For BAIAP2 (Source: Uniprot.org, NCBI)

Gene Name

BAIAP2

Full Name

Brain-specific angiogenesis inhibitor 1-associated protein 2

Weight

57.3 kDa

Alternative Names

BAI1-associated protein 2IRS-58; BAI-associated protein 2; BAP2; brain-specific angiogenesis inhibitor 1-associated protein 2; Fas ligand-associated factor 3; FLAF3; Insulin receptor substrate p53; Insulin receptor substrate p53/p58; Insulin receptor substrate protein of 53 kDa; IRSP53; IRSp53/58; Protein BAP2 BAIAP2 BAP2, FLAF3, IRSP53, WAML BAR/IMD domain containing adaptor protein 2 brain-specific angiogenesis inhibitor 1-associated protein 2|BAI1 associated protein 2|IRS-58|IRSp53/58|WASP and MIM like|fas ligand-associated factor 3|insulin receptor substrate of 53 kDa|insulin receptor substrate p53/p58|insulin receptor substrate protein of 53 kDa

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BAIAP2, check out the BAIAP2 Infographic

BAIAP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BAIAP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UQB8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BAIAP2 (NM_006340) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BAIAP2 (NM_006340) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BAIAP2 (NM_006340) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UQB8
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.