ATP5PD (NM_006356) Human Recombinant Protein

ATP5PD protein,

Product Info Summary

SKU: PROTO75947
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ATP5PD (NM_006356) Human Recombinant Protein

View all ATP5PD recombinant proteins

SKU/Catalog Number

PROTO75947

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d (ATP5H), nuclear gene encoding mitochondrial protein, transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ATP5PD (NM_006356) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75947)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.3 kDa

Amino Acid Sequence

MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

Validation Images & Assay Conditions

Gene/Protein Information For ATP5PD (Source: Uniprot.org, NCBI)

Gene Name

ATP5PD

Full Name

ATP synthase subunit d, mitochondrial

Weight

18.3 kDa

Superfamily

ATPase d subunit family

Alternative Names

ATP synthase subunit d, mitochondrial ATP5PD APT5H, ATP5H, ATPQ ATP synthase peripheral stalk subunit d ATP synthase subunit d, mitochondrial|ATP synthase D chain, mitochondrial|ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d|ATP synthase, H+ transporting, mitochondrial F1F0, subunit d|ATP synthase, H+ transporting, mitochondrial Fo complex subunit D|ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d|ATPase subunit d|My032 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ATP5PD, check out the ATP5PD Infographic

ATP5PD infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATP5PD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75947

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ATP5PD (NM_006356) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ATP5PD (NM_006356) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ATP5PD (NM_006356) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75947
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.