Anti-TNF alpha Antibody

TNF-alpha antibody

Boster Bio Anti-TNF alpha Antibody catalog # PA1079. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 80 publication(s).

Product Info Summary

SKU: PA1079
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-TNF alpha Antibody

View all TNF-alpha Antibodies

SKU/Catalog Number

PA1079

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-TNF alpha Antibody catalog # PA1079. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TNF alpha Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PA1079)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human TNF alpha, different from the related mouse sequence by five amino acids, and rat sequence by seven amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PA1079 is reactive to TNF in Human, Mouse, Rat

Applications

PA1079 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Observed Molecular Weight

25 kDa

Calculated molecular weight

25503 MW

Background of TNF-alpha

TNF alpha (Tumor Necrosis Factor alpha) gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat
Flow Cytometry (Fixed), 1-3 μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For TNF (Source: Uniprot.org, NCBI)

Gene Name

TNF

Full Name

Tumor necrosis factor

Weight

25503 MW

Superfamily

Tumor necrosis factor family

Alternative Names

APC1 protein; Cachectin; Cachetin; DIF; TNF; TNF, monocyte-derived; TNFA; TNF-A; TNFalpha; TNF-alpha; TNF-alphacachectin; TNFATNF, macrophage-derived; TNFG1F; TNFSF1A; TNFSF2; TNFSF2TNF superfamily, member 2; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor alpha; Tumor necrosis factor ligand superfamily member 2; tumor necrosis factor; tumor necrosis factor-alpha TNF DIF-alpha, TNFA, TNFSF2, TNLG1F, TNF tumor necrosis factor tumor necrosis factor|APC1 protein|TNF, macrophage-derived|TNF, monocyte-derived|TNF-a|tumor necrosis factor ligand 1F|tumor necrosis factor ligand superfamily member 2|tumor necrosis factor-alpha

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on TNF, check out the TNF Infographic

TNF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TNF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PA1079 has been cited in 80 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Immunohistochemical detection of the cytokine and chemokine expression in the gut of lambs and kids with coccidiosis

Wang B,Gao C,Zhang P,Sun W,Zhang J,Gao J.The increased motion of lumbar induces ligamentum flavum hypertrophy in a rat model. BMC Musculoskelet Disord.2021 Apr 6;22(1):334.doi:10.1186/s12891-021-04203-x.PMID:33823825.
Species: Human,Rat
PA1079 usage in article: APP:IHC, SAMPLE:SPINAL CORD TISSUE, DILUTION:1: 100

Yang Ping,Yingpeng Li,Shaowa Lü,Yali Sun,Wanmeng Zhang,Jialin Wu,Ting Liu,Yongji Li,A study of nanometre aggregates formation mechanism and antipyretic effect in Bai-Hu-Tang, an ancient Chinese herbal decoction,Biomedicine & Pharmacotherapy,Volume 124,202
Species: Rat
PA1079 usage in article: APP:WB, SAMPLE:HYPOTHALMIC TISSUE, DILUTION:NA

El Naggar EE,Mohamed EA,Borg TM,El-Sheakh AR,Hamed MF.Colon Targeting of Naringin for Enhanced Cytoprotection Against Indomethacin-Induced Colitis in Rabbits.Drug Des Devel Ther.2020 Feb 19;14:677-696.doi:10.2147/DDDT.S218357.PMID:32109993;PMCID:PMC703841
Species: New Zealand Rabbit
PA1079 usage in article: APP:IHC, SAMPLE:COLON TISSUE, DILUTION:1:100

Baojian Wang,Chunyu Gao,Liguo Zhu et al.Lumbar Instability Induces Ligamentum Flavum Hypertrophy in a Rat Model, 08 January 2021, PREPRINT (Version 1) available at Research Square [https://doi.org/10.21203/rs.3.rs-140228/v1]
Species: Human,Rat
PA1079 usage in article: APP:IHC, SAMPLE:POSTERIOR LUMBAR SPINAL TISSUE, DILUTION:1:100

Dan min Wang,Yao Gong,Zhi duo Hou et al.Comparison of Sacroiliac Biopsies and Magnetic Resonance Imaging Examinations in Non-Radiographic Axial Spondyloarthritis, 05 January 2021, PREPRINT (Version 1) available at Research Square [https://doi.org/10.21203
Species: Human
PA1079 usage in article: APP:IHC, SAMPLE:SIJ TISSUE, DILUTION:NA

Yang QQ,Li HN,Zhang ST,Yu YL,Wei W,Zhang X,Wang JY,Zeng XY.Red nucleus IL-6 mediates the maintenance of neuropathic pain by inducing the productions of TNF-α and IL-1β through the JAK2/STAT3 and ERK signaling pathways.Neuropathology.2020 Aug;40(4):347-357
Species: Rat
PA1079 usage in article: APP:WB, SAMPLE:RN TISSUE, DILUTION:1:300

Lan Q,Lu R,Chen H,Pang Y, Xiong F,Shen C,Qin Z,Zheng L,Xu G,Zhao J.MMP-13 enzyme and pH responsive theranostic nanoplatform for osteoarthritis.J Nanobiotechnology.2020 Aug 27;18(1):117.doi:10.1186/s12951-020-00666-7. PMID:32854712;PMCID:PMC7450974.
Species: Mouse
PA1079 usage in article: APP:IF, SAMPLE:CHONDROCYTES, DILUTION:1:100

Sun S,Wang Y,Du Y,Sun Q,He L,Zhu E,Li J. Oxidative stress-mediated hepatotoxicity in rats induced by ethanol extracts of different parts of Chloranthus serratus.Pharm Biol.2020 Dec;58(1):1277-1289.doi:10.1080/ n13880209.2020.1859552.PMID: 33355514.
Species: Rat
PA1079 usage in article: APP:IHC, SAMPLE:LIVER TISSUE, DILUTION:NA

Guo Y,Gu R,Yu J,Lei B,Gan D,Xu G.Synthetic Glucocorticoid-Induced Leucine Zipper Peptide Inhibits Lipopolysaccharide-Induced Ocular Inflammation in Rats.Ophthalmic Res.2020;63(4):434-442.doi:10.1159/000505 003.Epub 2019 Nov 26.PMID:31770752.
Species: Rat
PA1079 usage in article: APP:WB, SAMPLE:RETINAL TISSUE, DILUTION:1:500

Have you used Anti-TNF alpha Antibody?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-TNF alpha Antibody

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-TNF alpha Antibody

Question

We are currently using anti-TNF alpha antibody PA1079 for rat tissue, and we are happy with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2020-05-01

Answer

The anti-TNF alpha antibody (PA1079) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-05-01

Question

I see that the anti-TNF alpha antibody PA1079 works with IF, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-04-17

Answer

You can find protocols for IF on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-04-17

Question

Do you have a BSA free version of anti-TNF alpha antibody PA1079 available?

Verified Customer

Verified customer

Asked: 2020-02-25

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-TNF alpha antibody PA1079 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-02-25

Question

My lab would like using your anti-TNF alpha antibody for positive regulation of membrane protein ectodomain proteolysis studies. Has this antibody been tested with western blotting on a431 whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-12-23

Answer

We appreciate your inquiry. This PA1079 anti-TNF alpha antibody is tested on human placenta tissue, hela whole cell lysates, a431 whole cell lysates, a549 whole cell lysates, k562 whole cell lysates. It is guaranteed to work for IF, IHC-P, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-12-23

Question

Our lab want to know about to test anti-TNF alpha antibody PA1079 on mouse prostatic carcinoma for research purposes, then I may be interested in using anti-TNF alpha antibody PA1079 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

W. Wu

Verified customer

Asked: 2019-11-18

Answer

The products we sell, including anti-TNF alpha antibody PA1079, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-11-18

Question

Is a blocking peptide available for product anti-TNF alpha antibody (PA1079)?

Verified Customer

Verified customer

Asked: 2019-06-13

Answer

We do provide the blocking peptide for product anti-TNF alpha antibody (PA1079). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-06-13

Question

See attached the WB image, lot number and protocol we used for prostatic carcinoma using anti-TNF alpha antibody PA1079. Please let me know if you require anything else.

R. Thomas

Verified customer

Asked: 2019-06-12

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-12

Question

We ordered your anti-TNF alpha antibody for IHC-P on leukocyte a few years ago. I am using rat, and We are going to use the antibody for WB next. I am interested in examining leukocyte as well as prostatic carcinoma in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

J. Krishna

Verified customer

Asked: 2019-05-31

Answer

I viewed the website and datasheets of our anti-TNF alpha antibody and it appears that PA1079 has been tested on rat in both IHC-P and WB. Thus PA1079 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-05-31

Question

My question regarding product PA1079, anti-TNF alpha antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-08-06

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PA1079 anti-TNF alpha antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-08-06

Question

Our lab were well pleased with the WB result of your anti-TNF alpha antibody. However we have observed positive staining in blood cell membrane using this antibody. Is that expected? Could you tell me where is TNF supposed to be expressed?

Verified Customer

Verified customer

Asked: 2017-07-24

Answer

From literature, blood does express TNF. Generally TNF expresses in cell membrane. Regarding which tissues have TNF expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Prostatic carcinoma, Pubmed ID: 8597870, 10205166

Boster Scientific Support

Answered: 2017-07-24

Question

We have observed staining in human leukocyte. Are there any suggestions? Is anti-TNF alpha antibody supposed to stain leukocyte positively?

Verified Customer

Verified customer

Asked: 2017-07-19

Answer

According to literature leukocyte does express TNF. According to Uniprot.org, TNF is expressed in leukocyte, blood, prostatic carcinoma, among other tissues. Regarding which tissues have TNF expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Prostatic carcinoma, Pubmed ID: 8597870, 10205166

Boster Scientific Support

Answered: 2017-07-19

Question

I was wanting to use your anti-TNF alpha antibody for IF for mouse prostatic carcinoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse prostatic carcinoma identification?

L. Thomas

Verified customer

Asked: 2016-12-01

Answer

It shows on the product datasheet, PA1079 anti-TNF alpha antibody has been validated for IF, IHC-P, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse prostatic carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-12-01

Question

Is this PA1079 anti-TNF alpha antibody reactive to the isotypes of TNF?

M. Edwards

Verified customer

Asked: 2015-06-18

Answer

The immunogen of PA1079 anti-TNF alpha antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human TNF(201-233aa QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL), different from the related mouse sequence by five amino acids, and rat sequence by seven amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2015-06-18

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for prostatic carcinoma using anti-TNF alpha antibody PA1079. Let me know if you need anything else.

A. Collins

Verified customer

Asked: 2015-02-18

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2015-02-18

Question

Does anti-TNF alpha antibody PA1079 work for IF with prostatic carcinoma?

E. Anderson

Verified customer

Asked: 2014-03-05

Answer

According to the expression profile of prostatic carcinoma, TNF is highly expressed in prostatic carcinoma. So, it is likely that anti-TNF alpha antibody PA1079 will work for IF with prostatic carcinoma.

Boster Scientific Support

Answered: 2014-03-05

Question

Would PA1079 anti-TNF alpha antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

K. Collins

Verified customer

Asked: 2013-07-12

Answer

It shows on the product datasheet, PA1079 anti-TNF alpha antibody as been validated on IF. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2013-07-12

Order DetailsPrice
PA1079

100μg

$370
PA1079-10ug

10μg sample (liquid)

$99
PA1079-Biotin

100 μg Biotin conjugated

$570
PA1079-Cy3

100 μg Cy3 conjugated

$570
PA1079-Dylight488

100 μg Dylight488 conjugated

$570
PA1079-Dylight550

100 μg Dylight550 conjugated

$570
PA1079-Dylight594

100 μg Dylight594 conjugated

$570
PA1079-FITC

100 μg FITC conjugated

$570
PA1079-HRP

100 μg HRP conjugated

$570
PA1079-APC

100 μg APC conjugated

$670
PA1079-PE

100 μg PE conjugated

$670
PA1079-iFluor647

100 μg iFluor647 conjugated

$670
PA1079-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PA1079
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.