Product Info Summary
SKU: | A00771-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-TLS/FUS Antibody Picoband®
SKU/Catalog Number
A00771-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-TLS/FUS Antibody Picoband® catalog # A00771-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-TLS/FUS Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00771-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TLS / FUS, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00771-1 is reactive to FUS in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
75 kDa
Calculated molecular weight
53.426kDa
Background of FUS
RNA-binding protein FUS/TLS (Fused in Sarcoma/Translocated in Sarcoma) is a protein that in humans is encoded by the FUS gene. This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00771-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: human HepG2 whole cell, human K562 whole cell, mouse NIH3T3 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of TLS / FUS using anti-TLS / FUS antibody (A00771-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human HepG2 whole cell lysates,
Lane 2: human K562 whole cell lysates,
Lane 3: mouse NIH3T3 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TLS / FUS antigen affinity purified polyclonal antibody (Catalog # A00771-1) at 0.5 ug/mL overnight at 4 then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for TLS / FUS at approximately 75KD. The expected band size for TLS / FUS is at 53KD.
Protein Target Info & Infographic
Gene/Protein Information For FUS (Source: Uniprot.org, NCBI)
Gene Name
FUS
Full Name
RNA-binding protein FUS
Weight
53.426kDa
Superfamily
RRM TET family
Alternative Names
RNA-binding protein FUS; 75 kDa DNA-pairing protein; Oncogene FUS; Oncogene TLS; POMp75; Translocated in liposarcoma protein; FUS; TLS; FUS ALS6, ETM41, HNRNPP2, POMP75, TLS, altFUS, FUS FUS RNA binding protein RNA-binding protein FUS|75 kDa DNA-pairing protein|fus-like protein|fused in sarcoma|fusion gene in myxoid liposarcoma|heterogeneous nuclear ribonucleoprotein P2|oncogene FUS|oncogene TLS|translocated in liposarcoma protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on FUS, check out the FUS Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FUS: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-TLS/FUS Antibody Picoband® (A00771-1)
Hello CJ!
No publications found for A00771-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-TLS/FUS Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-TLS/FUS Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-TLS/FUS Antibody Picoband®
Question
Do you have a BSA free version of anti-TLS/FUS antibody A00771-1 available?
Verified Customer
Verified customer
Asked: 2020-04-07
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-TLS/FUS antibody A00771-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-07
Question
I see that the anti-TLS/FUS antibody A00771-1 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-02-24
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-02-24
Question
We were well pleased with the WB result of your anti-TLS/FUS antibody. However we have observed positive staining in erythroleukemia nucleus using this antibody. Is that expected? Could you tell me where is FUS supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-12-31
Answer
Based on literature, erythroleukemia does express FUS. Generally FUS expresses in nucleus. Regarding which tissues have FUS expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 24129315
Erythroleukemia, Pubmed ID: 23186163
Fetal brain cortex, Pubmed ID: 8187069, 9660765
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Lung, and Lymph, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-12-31
Question
I have attached the WB image, lot number and protocol we used for lung lymph using anti-TLS/FUS antibody A00771-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-12-09
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-12-09
Question
I have a question about product A00771-1, anti-TLS/FUS antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-11-21
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00771-1 anti-TLS/FUS antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-11-21
Question
Will anti-TLS/FUS antibody A00771-1 work for WB with lung lymph?
Verified Customer
Verified customer
Asked: 2019-09-02
Answer
According to the expression profile of lung lymph, FUS is highly expressed in lung lymph. So, it is likely that anti-TLS/FUS antibody A00771-1 will work for WB with lung lymph.
Boster Scientific Support
Answered: 2019-09-02
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung lymph using anti-TLS/FUS antibody A00771-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-05-20
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-05-20
Question
We have observed staining in mouse fetal brain cortex. Any tips? Is anti-TLS/FUS antibody supposed to stain fetal brain cortex positively?
Verified Customer
Verified customer
Asked: 2019-02-27
Answer
From what I have seen in literature fetal brain cortex does express FUS. From what I have seen in Uniprot.org, FUS is expressed in right testis, lung lymph, fetal brain cortex, leukemic t-cell, erythroleukemia, liver, colon carcinoma, among other tissues. Regarding which tissues have FUS expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 24129315
Erythroleukemia, Pubmed ID: 23186163
Fetal brain cortex, Pubmed ID: 8187069, 9660765
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Lung, and Lymph, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-02-27
Question
We are currently using anti-TLS/FUS antibody A00771-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on canine tissues as well?
F. Mitchell
Verified customer
Asked: 2018-08-21
Answer
The anti-TLS/FUS antibody (A00771-1) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-08-21
Question
I am interested in to test anti-TLS/FUS antibody A00771-1 on rat lung lymph for research purposes, then I may be interested in using anti-TLS/FUS antibody A00771-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-06-20
Answer
The products we sell, including anti-TLS/FUS antibody A00771-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-06-20
Question
Is a blocking peptide available for product anti-TLS/FUS antibody (A00771-1)?
Verified Customer
Verified customer
Asked: 2017-07-05
Answer
We do provide the blocking peptide for product anti-TLS/FUS antibody (A00771-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-07-05
Question
Would A00771-1 anti-TLS/FUS antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2017-06-28
Answer
As indicated on the product datasheet, A00771-1 anti-TLS/FUS antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-06-28
Question
Is this A00771-1 anti-TLS/FUS antibody reactive to the isotypes of FUS?
F. Mitchell
Verified customer
Asked: 2016-12-16
Answer
The immunogen of A00771-1 anti-TLS/FUS antibody is A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2016-12-16
Question
I was wanting to use your anti-TLS/FUS antibody for WB for rat lung lymph on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat lung lymph identification?
R. Krishna
Verified customer
Asked: 2013-09-02
Answer
As indicated on the product datasheet, A00771-1 anti-TLS/FUS antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat lung lymph in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-09-02