Click image to see more details
Product Info Summary
| SKU: | PB9507 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Pig, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SOX5 Antibody Picoband®
SKU/Catalog Number
PB9507
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SOX5 Antibody Picoband® catalog # PB9507. Tested in WB applications. This antibody reacts with Human, Mouse, Pig, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SOX5 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9507)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5, different from the related mouse sequence by two amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9507 is reactive to SOX5 in Human, Mouse, Pig, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
84 kDa
Calculated molecular weight
84026 MW
Background of SOX5
Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9507 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat, Pig
Positive Control
WB: Rat Liver Tissue, Rat Testis Tissue, Rat Brain Tissue, HELA Whole Cell, A549 Whole Cell, All lanes: pig adipose cells, mouse spleen tissue, mouse thymus tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SOX5 using anti-SOX5 antibody (PB9507).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Liver Tissue Lysate at 50ug,
Lane 2: Rat Testis Tissue Lysate at 50ug,
Lane 3: Rat Brain Tissue Lysate at 50ug,
Lane 4: HELA Whole Cell Lysate at 40ug,
Lane 5: A549 Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SOX5 antigen affinity purified polyclonal antibody (Catalog # PB9507) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SOX5 at approximately 84 kDa. The expected band size for SOX5 is at 84 kDa.
Click image to see more details
Figure 2. Western blot analysis of SOX5 using anti-SOX5 antibody (PB9507).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 40ug of sample under reducing conditions.
All lanes: pig adipose cells
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SOX5 antigen affinity purified polyclonal antibody (Catalog # PB9507) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SOX5 at approximately 84KD. The expected band size for SOX5 is at 84KD.
Click image to see more details
Figure 3. Western blot analysis of SOX5 using anti-SOX5 antibody (PB9507).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: mouse spleen tissue lysate,
Lane 2: mouse thymus tissue lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SOX5 antigen affinity purified polyclonal antibody (Catalog # PB9507) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SOX5 at approximately 84KD. The expected band size for SOX5 is at 84KD.
Protein Target Info & Infographic
Gene/Protein Information For SOX5 (Source: Uniprot.org, NCBI)
Gene Name
SOX5
Full Name
Transcription factor SOX-5
Weight
84026 MW
Alternative Names
Transcription factor SOX-5;SOX5; SOX5 L-SOX5, L-SOX5B, L-SOX5F, LAMSHF SRY-box transcription factor 5 transcription factor SOX-5|SRY (sex determining region Y)-box 5|SRY-box 5
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SOX5, check out the SOX5 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SOX5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SOX5 Antibody Picoband® (PB9507)
Hello CJ!
No publications found for PB9507
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SOX5 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-SOX5 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-SOX5 Antibody Picoband®
Question
We are currently using anti-SOX5 antibody PB9507 for pig tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, pig, rat. Is it possible that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2020-05-07
Answer
The anti-SOX5 antibody (PB9507) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-05-07
Question
Is a blocking peptide available for product anti-SOX5 antibody (PB9507)?
Verified Customer
Verified customer
Asked: 2020-04-24
Answer
We do provide the blocking peptide for product anti-SOX5 antibody (PB9507). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-04-24
Question
See attached the WB image, lot number and protocol we used for cervix carcinoma using anti-SOX5 antibody PB9507. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-03-05
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-03-05
Question
Is this PB9507 anti-SOX5 antibody reactive to the isotypes of SOX5?
R. Roberts
Verified customer
Asked: 2014-06-02
Answer
The immunogen of PB9507 anti-SOX5 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-06-02
Question
I was wanting to use your anti-SOX5 antibody for WB for human cervix carcinoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human cervix carcinoma identification?
S. Bhatt
Verified customer
Asked: 2013-01-28
Answer
As indicated on the product datasheet, PB9507 anti-SOX5 antibody has been validated for WB on human, mouse, pig, rat tissues. We have an innovator award program that if you test this antibody and show it works in human cervix carcinoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-01-28
