Anti-SOX5 Antibody Picoband™

SOX5 antibody

Boster Bio Anti-SOX5 Antibody Picoband™ catalog # PB9507. Tested in WB applications. This antibody reacts with Human, Mouse, Pig, Rat.

Product Info Summary

SKU: PB9507
Size: 100 μg/vial
Reactive Species: Human, Mouse, Pig, Rat
Host: Rabbit
Application: WB

Product Name

Anti-SOX5 Antibody Picoband™

View all SOX5 Antibodies

SKU/Catalog Number

PB9507

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SOX5 Antibody Picoband™ catalog # PB9507. Tested in WB applications. This antibody reacts with Human, Mouse, Pig, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SOX5 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9507)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5, different from the related mouse sequence by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9507 is reactive to SOX5 in Human, Mouse, Pig, Rat

Applications

PB9507 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

84 kDa

Calculated molecular weight

84026 MW

Background of SOX5

Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat, Pig

Validation Images & Assay Conditions

Gene/Protein Information For SOX5 (Source: Uniprot.org, NCBI)

Gene Name

SOX5

Full Name

Transcription factor SOX-5

Weight

84026 MW

Alternative Names

L-SOX5; MGC35153; SOX5; SRY (sex determining region Y)-box 5; transcription factor SOX-5 SOX5 L-SOX5, L-SOX5B, L-SOX5F, LAMSHF SRY-box transcription factor 5 transcription factor SOX-5|SRY (sex determining region Y)-box 5|SRY-box 5

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on SOX5, check out the SOX5 Infographic

SOX5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SOX5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9507

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SOX5 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-SOX5 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-SOX5 Antibody Picoband™

Question

We are currently using anti-SOX5 antibody PB9507 for pig tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, pig, rat. Is it possible that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2020-05-07

Answer

The anti-SOX5 antibody (PB9507) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-05-07

Question

Is a blocking peptide available for product anti-SOX5 antibody (PB9507)?

Verified Customer

Verified customer

Asked: 2020-04-24

Answer

We do provide the blocking peptide for product anti-SOX5 antibody (PB9507). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-04-24

Question

See attached the WB image, lot number and protocol we used for cervix carcinoma using anti-SOX5 antibody PB9507. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-03-05

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-03-05

Question

Is this PB9507 anti-SOX5 antibody reactive to the isotypes of SOX5?

R. Roberts

Verified customer

Asked: 2014-06-02

Answer

The immunogen of PB9507 anti-SOX5 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-06-02

Question

I was wanting to use your anti-SOX5 antibody for WB for human cervix carcinoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human cervix carcinoma identification?

S. Bhatt

Verified customer

Asked: 2013-01-28

Answer

As indicated on the product datasheet, PB9507 anti-SOX5 antibody has been validated for WB on human, mouse, pig, rat tissues. We have an innovator award program that if you test this antibody and show it works in human cervix carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-01-28

Order DetailsPrice
PB9507

100μg

$370
PB9507-10ug

10μg sample (liquid)

$99
PB9507-Biotin

100 μg Biotin conjugated

$570
PB9507-Cy3

100 μg Cy3 conjugated

$570
PB9507-Dylight488

100 μg Dylight488 conjugated

$570
PB9507-Dylight550

100 μg Dylight550 conjugated

$570
PB9507-Dylight594

100 μg Dylight594 conjugated

$570
PB9507-FITC

100 μg FITC conjugated

$570
PB9507-HRP

100 μg HRP conjugated

$570
PB9507-APC

100 μg APC conjugated

$670
PB9507-PE

100 μg PE conjugated

$670
PB9507-iFluor647

100 μg iFluor647 conjugated

$670
PB9507-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9507
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.