Click image to see more details
Product Info Summary
| SKU: | A09720-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SLC7A3 Antibody Picoband®
View all CAT3/SLC7A3 Antibodies
SKU/Catalog Number
A09720-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SLC7A3 Antibody Picoband® catalog # A09720-1. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SLC7A3 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A09720-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3, different from the related mouse and rat sequences by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A09720-1 is reactive to SLC7A3 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
67 kDa
Calculated molecular weight
67169 MW
Background of CAT3/SLC7A3
Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene. This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein. The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A09720-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: human A431 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SLC7A3 using anti-SLC7A3 antibody (A09720-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human A431 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC7A3 antigen affinity purified polyclonal antibody (Catalog # A09720-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SLC7A3 at approximately 67KD. The expected band size for SLC7A3 is at 67KD.
Protein Target Info & Infographic
Gene/Protein Information For SLC7A3 (Source: Uniprot.org, NCBI)
Gene Name
SLC7A3
Full Name
Cationic amino acid transporter 3
Weight
67169 MW
Superfamily
amino acid-polyamine-organocation (APC) superfamily
Alternative Names
Cationic amino acid transporter 3;CAT-3;CAT3;Cationic amino acid transporter y+;Solute carrier family 7 member 3;SLC7A3;ATRC3, CAT3; Slc7a3|Atr, Atrc3, CAT-3, CAT3, Cat, SLC, SLC7A1, SLC7A2|solute carrier family 7 (cationic amino acid transporter, y+ system), member 3|cationic amino acid transporter 3|amino acid transporter, cationic 3|cationic amino acid transporter y+|solute carrier family 7 member 3
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SLC7A3, check out the SLC7A3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SLC7A3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SLC7A3 Antibody Picoband® (A09720-1)
Hello CJ!
No publications found for A09720-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SLC7A3 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-SLC7A3 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-SLC7A3 Antibody Picoband®
Question
Is a blocking peptide available for product anti-SLC7A3 antibody (A09720-1)?
Verified Customer
Verified customer
Asked: 2020-02-11
Answer
We do provide the blocking peptide for product anti-SLC7A3 antibody (A09720-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-02-11
Question
Is this A09720-1 anti-SLC7A3 antibody reactive to the isotypes of SLC7A3?
Verified Customer
Verified customer
Asked: 2020-02-04
Answer
The immunogen of A09720-1 anti-SLC7A3 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-02-04
Question
We are currently using anti-SLC7A3 antibody A09720-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-24
Answer
The anti-SLC7A3 antibody (A09720-1) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-24
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cauda epididymis using anti-SLC7A3 antibody A09720-1. Let me know if you need anything else.
A. Patel
Verified customer
Asked: 2016-05-16
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-05-16
