Product Info Summary
SKU: | PB10095 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SAFB Antibody Picoband®
SKU/Catalog Number
PB10095
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SAFB Antibody Picoband® catalog # PB10095. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SAFB Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10095)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SAFB, different from the related mouse and rat sequences by five amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB10095 is reactive to SAFB in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
150 kDa
Calculated molecular weight
102642 MW
Background of SAFB
Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB10095 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: HELA whole cell, MCF-7 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SAFB using anti-SAFB antibody (PB10095).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: HELA whole cell lysates,
Lane 2: MCF-7 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SAFB antigen affinity purified polyclonal antibody (Catalog # PB10095) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SAFB at approximately 150 kDa. The expected band size for SAFB is at 103 kDa.
Protein Target Info & Infographic
Gene/Protein Information For SAFB (Source: Uniprot.org, NCBI)
Gene Name
SAFB
Full Name
Scaffold attachment factor B1
Weight
102642 MW
Alternative Names
Scaffold attachment factor B1;SAF-B;SAF-B1;HSP27 estrogen response element-TATA box-binding protein;HSP27 ERE-TATA-binding protein;SAFB;HAP, HET, SAFB1; SAFB HAP, HET, SAB-B1, SAF-B, SAF-B11, SAFB scaffold attachment factor B scaffold attachment factor B1|HSP27 ERE-TATA-binding protein|HSP27 estrogen response element-TATA box-binding protein|Hsp27 ERE-TATA binding protein|glutathione S-transferase fusion protein|heat-shock protein (HSP27) estrogen response element and TATA box-binding protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SAFB, check out the SAFB Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SAFB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SAFB Antibody Picoband® (PB10095)
Hello CJ!
No publications found for PB10095
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SAFB Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-SAFB Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-SAFB Antibody Picoband®
Question
Is a blocking peptide available for product anti-SAFB antibody (PB10095)?
Verified Customer
Verified customer
Asked: 2019-12-31
Answer
We do provide the blocking peptide for product anti-SAFB antibody (PB10095). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-31
Question
We need to test anti-SAFB antibody PB10095 on human colon carcinoma for research purposes, then I may be interested in using anti-SAFB antibody PB10095 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-10-22
Answer
The products we sell, including anti-SAFB antibody PB10095, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-10-22
Question
Is this PB10095 anti-SAFB antibody reactive to the isotypes of SAFB?
Verified Customer
Verified customer
Asked: 2019-08-26
Answer
The immunogen of PB10095 anti-SAFB antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human SAFB (715-754aa DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR), different from the related mouse and rat sequences by five amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-08-26
Question
Can you help my question with product PB10095, anti-SAFB antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
E. Miller
Verified customer
Asked: 2019-05-23
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10095 anti-SAFB antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-05-23
Question
Would PB10095 anti-SAFB antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-02-12
Answer
It shows on the product datasheet, PB10095 anti-SAFB antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-02-12
Question
I see that the anti-SAFB antibody PB10095 works with WB, what is the protocol used to produce the result images on the product page?
J. Krishna
Verified customer
Asked: 2014-07-18
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-07-18
Question
We are currently using anti-SAFB antibody PB10095 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on monkey tissues as well?
E. Zhang
Verified customer
Asked: 2013-12-25
Answer
The anti-SAFB antibody (PB10095) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2013-12-25