Anti-SAFB Antibody Picoband®

SAFB antibody

Boster Bio Anti-SAFB Antibody Picoband® catalog # PB10095. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB10095
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-SAFB Antibody Picoband®

View all SAFB Antibodies

SKU/Catalog Number

PB10095

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SAFB Antibody Picoband® catalog # PB10095. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SAFB Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10095)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human SAFB, different from the related mouse and rat sequences by five amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB10095 is reactive to SAFB in Human

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

150 kDa

Calculated molecular weight

102642 MW

Background of SAFB

Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB10095 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Positive Control

WB: HELA whole cell, MCF-7 whole cell

Validation Images & Assay Conditions

Gene/Protein Information For SAFB (Source: Uniprot.org, NCBI)

Gene Name

SAFB

Full Name

Scaffold attachment factor B1

Weight

102642 MW

Alternative Names

Scaffold attachment factor B1;SAF-B;SAF-B1;HSP27 estrogen response element-TATA box-binding protein;HSP27 ERE-TATA-binding protein;SAFB;HAP, HET, SAFB1; SAFB HAP, HET, SAB-B1, SAF-B, SAF-B11, SAFB scaffold attachment factor B scaffold attachment factor B1|HSP27 ERE-TATA-binding protein|HSP27 estrogen response element-TATA box-binding protein|Hsp27 ERE-TATA binding protein|glutathione S-transferase fusion protein|heat-shock protein (HSP27) estrogen response element and TATA box-binding protein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on SAFB, check out the SAFB Infographic

SAFB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SAFB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB10095

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SAFB Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-SAFB Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-SAFB Antibody Picoband®

Question

Is a blocking peptide available for product anti-SAFB antibody (PB10095)?

Verified Customer

Verified customer

Asked: 2019-12-31

Answer

We do provide the blocking peptide for product anti-SAFB antibody (PB10095). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-12-31

Question

We need to test anti-SAFB antibody PB10095 on human colon carcinoma for research purposes, then I may be interested in using anti-SAFB antibody PB10095 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-10-22

Answer

The products we sell, including anti-SAFB antibody PB10095, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-10-22

Question

Is this PB10095 anti-SAFB antibody reactive to the isotypes of SAFB?

Verified Customer

Verified customer

Asked: 2019-08-26

Answer

The immunogen of PB10095 anti-SAFB antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human SAFB (715-754aa DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR), different from the related mouse and rat sequences by five amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-26

Question

Can you help my question with product PB10095, anti-SAFB antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

E. Miller

Verified customer

Asked: 2019-05-23

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10095 anti-SAFB antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-05-23

Question

Would PB10095 anti-SAFB antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-02-12

Answer

It shows on the product datasheet, PB10095 anti-SAFB antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-02-12

Question

I see that the anti-SAFB antibody PB10095 works with WB, what is the protocol used to produce the result images on the product page?

J. Krishna

Verified customer

Asked: 2014-07-18

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2014-07-18

Question

We are currently using anti-SAFB antibody PB10095 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on monkey tissues as well?

E. Zhang

Verified customer

Asked: 2013-12-25

Answer

The anti-SAFB antibody (PB10095) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2013-12-25

Order DetailsPrice
PB10095

100μg

$370
PB10095-10ug

10μg sample (liquid)

$99
PB10095-Biotin

100 μg Biotin conjugated

$570
PB10095-Cy3

100 μg Cy3 conjugated

$570
PB10095-Dylight488

100 μg Dylight488 conjugated

$570
PB10095-Dylight550

100 μg Dylight550 conjugated

$570
PB10095-Dylight594

100 μg Dylight594 conjugated

$570
PB10095-FITC

100 μg FITC conjugated

$570
PB10095-HRP

100 μg HRP conjugated

$570
PB10095-APC

100 μg APC conjugated

$670
PB10095-PE

100 μg PE conjugated

$670
PB10095-iFluor647

100 μg iFluor647 conjugated

$670
PB10095-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10095
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.