Click image to see more details
Product Info Summary
| SKU: | PB9817 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-RRM2 Antibody Picoband®
SKU/Catalog Number
PB9817
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-RRM2 Antibody Picoband® catalog # PB9817. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-RRM2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9817)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2, different from the related mouse and rat sequences by eight amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9817 is reactive to RRM2 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
50 kDa
Calculated molecular weight
44878 MW
Background of RRM2
Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9817 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: Rat Cardiac Muscle Tissue, Mouse Cardiac Muscle Tissue, A431 Whole Cell, HELA Whole Cell
IHC: human mammary cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of RRM2 using anti-RRM2 antibody (PB9817).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Cardiac Muscle Tissue Lysate at 50ug,
Lane 2: Mouse Cardiac Muscle Tissue Lysate at 50ug,
Lane 3: A431 Whole Cell Lysate at 40ug,
Lane 4: HELA Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RRM2 antigen affinity purified polyclonal antibody (Catalog # PB9817) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for RRM2 at approximately 50 kDa. The expected band size for RRM2 is at 50 kDa.
Click image to see more details
Figure 2. IHC analysis of RRM2 using anti-RRM2 antibody (PB9817).
RRM2 was detected in a paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-RRM2 Antibody (PB9817) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For RRM2 (Source: Uniprot.org, NCBI)
Gene Name
RRM2
Full Name
Ribonucleoside-diphosphate reductase subunit M2
Weight
44878 MW
Superfamily
ribonucleoside diphosphate reductase small chain family
Alternative Names
Ribonucleoside-diphosphate reductase subunit M2;1.17.4.1;Ribonucleotide reductase small chain;Ribonucleotide reductase small subunit;RRM2;RR2; RRM2 C2orf48, R2, RR2, RR2M ribonucleotide reductase regulatory subunit M2 ribonucleoside-diphosphate reductase subunit M2|ribonucleotide reductase M2 polypeptide|ribonucleotide reductase small chain|ribonucleotide reductase small subunit|uncharacterized protein C2orf48
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on RRM2, check out the RRM2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for RRM2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-RRM2 Antibody Picoband® (PB9817)
Hello CJ!
PB9817 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Xu Lx, Li Zh, Tao Yf, Li Rh, Fang F, Zhao H, Li G, Li Yh, Wang J, Feng X, Pan J. J Exp Clin Cancer Res. 2014 Dec 19;33:108. Doi: 10.1186/S13046-014-0108-3. Histone Acetyltransferase Inhibitor Ii Induces Apoptosis In Glioma Cell Lines Via The P53 S...
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-RRM2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-RRM2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
17 Customer Q&As for Anti-RRM2 Antibody Picoband®
Question
I have a question about product PB9817, anti-RRM2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-05-06
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9817 anti-RRM2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-05-06
Question
We have tried in the past anti-RRM2 antibody for WB on leukemic t-cell last year. I am using human, and We are going to use the antibody for IHC next. Our lab want to know about examining leukemic t-cell as well as muscle skin in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?
Verified Customer
Verified customer
Asked: 2020-04-24
Answer
I looked at the website and datasheets of our anti-RRM2 antibody and I see that PB9817 has been validated on human in both WB and IHC. Thus PB9817 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2020-04-24
Question
Is a blocking peptide available for product anti-RRM2 antibody (PB9817)?
Verified Customer
Verified customer
Asked: 2020-01-27
Answer
We do provide the blocking peptide for product anti-RRM2 antibody (PB9817). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-01-27
Question
See attached the WB image, lot number and protocol we used for cervix carcinoma using anti-RRM2 antibody PB9817. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-01-20
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-20
Question
My lab would like using your anti-RRM2 antibody for protein heterotetramerization studies. Has this antibody been tested with western blotting on mouse cardiac muscle tissue lysate? We would like to see some validation images before ordering.
A. Carter
Verified customer
Asked: 2019-12-02
Answer
We appreciate your inquiry. This PB9817 anti-RRM2 antibody is tested on rat cardiac muscle tissue lysate, mouse cardiac muscle tissue lysate, a431 whole cell lysate, hela whole cell lysate, mammary cancer tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-12-02
Question
We were happy with the WB result of your anti-RRM2 antibody. However we have observed positive staining in cervix carcinoma cytoplasm. using this antibody. Is that expected? Could you tell me where is RRM2 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-11-27
Answer
According to literature, cervix carcinoma does express RRM2. Generally RRM2 expresses in cytoplasm. Regarding which tissues have RRM2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18691976, 20068231
Leukemic T-cell, Pubmed ID: 19690332
Mammary carcinoma, Pubmed ID: 1627826
Muscle, and Skin, Pubmed ID: 15489334
Neonatal skin, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-11-27
Question
I see that the anti-RRM2 antibody PB9817 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-11-19
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-11-19
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cervix carcinoma using anti-RRM2 antibody PB9817. Let me know if you need anything else.
E. Zhang
Verified customer
Asked: 2019-11-11
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-11-11
Question
Would anti-RRM2 antibody PB9817 work for IHC with cervix carcinoma?
Verified Customer
Verified customer
Asked: 2019-10-16
Answer
According to the expression profile of cervix carcinoma, RRM2 is highly expressed in cervix carcinoma. So, it is likely that anti-RRM2 antibody PB9817 will work for IHC with cervix carcinoma.
Boster Scientific Support
Answered: 2019-10-16
Question
We have observed staining in rat secondary oocyte. Are there any suggestions? Is anti-RRM2 antibody supposed to stain secondary oocyte positively?
Verified Customer
Verified customer
Asked: 2019-06-18
Answer
From what I have seen in literature secondary oocyte does express RRM2. From what I have seen in Uniprot.org, RRM2 is expressed in secondary oocyte, mammary carcinoma, neonatal skin, muscle skin, cervix carcinoma, leukemic t-cell, among other tissues. Regarding which tissues have RRM2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18691976, 20068231
Leukemic T-cell, Pubmed ID: 19690332
Mammary carcinoma, Pubmed ID: 1627826
Muscle, and Skin, Pubmed ID: 15489334
Neonatal skin, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-06-18
Question
We are currently using anti-RRM2 antibody PB9817 for mouse tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2019-06-13
Answer
The anti-RRM2 antibody (PB9817) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-06-13
Question
Will anti-RRM2 antibody PB9817 work on feline WB with neonatal skin?
Verified Customer
Verified customer
Asked: 2019-01-29
Answer
Our lab technicians have not tested anti-RRM2 antibody PB9817 on feline. You can run a BLAST between feline and the immunogen sequence of anti-RRM2 antibody PB9817 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline neonatal skin in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-01-29
Question
I am looking for to test anti-RRM2 antibody PB9817 on mouse cervix carcinoma for research purposes, then I may be interested in using anti-RRM2 antibody PB9817 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-05-25
Answer
The products we sell, including anti-RRM2 antibody PB9817, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-05-25
Question
Do you have a BSA free version of anti-RRM2 antibody PB9817 available?
D. Williams
Verified customer
Asked: 2018-03-12
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-RRM2 antibody PB9817 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-03-12
Question
I was wanting to use your anti-RRM2 antibody for IHC for mouse cervix carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse cervix carcinoma identification?
Verified Customer
Verified customer
Asked: 2018-02-26
Answer
It shows on the product datasheet, PB9817 anti-RRM2 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse cervix carcinoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-02-26
Question
Is this PB9817 anti-RRM2 antibody reactive to the isotypes of RRM2?
Verified Customer
Verified customer
Asked: 2017-08-28
Answer
The immunogen of PB9817 anti-RRM2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT), different from the related mouse and rat sequences by eight amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-08-28
Question
Will PB9817 anti-RRM2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
B. Taylor
Verified customer
Asked: 2014-11-10
Answer
You can see on the product datasheet, PB9817 anti-RRM2 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2014-11-10
