Product Info Summary
SKU: | PB9842 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-RENT1/hUPF1 Antibody Picoband®
View all RENT1/UPF1/hUPF1 Antibodies
SKU/Catalog Number
PB9842
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-RENT1/hUPF1 Antibody Picoband® catalog # PB9842. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-RENT1/hUPF1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9842)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9842 is reactive to UPF1 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
140 kDa
Calculated molecular weight
124345 MW
Background of RENT1/UPF1/hUPF1
Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9842 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: human Hela whole cell, human Raji whole cell, human HepG2 whole cell, human SK-OV-3 whole cell, human PC-3 whole cell, human HEK293 whole cell, rat RH35 whole cell, mouse HEPA1-6 whole cell
IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue
ICC/IF: A431 cell
FCM: PC-3 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of RENT1/hUPF1 using anti-RENT1/hUPF1 antibody (PB9842).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human Raji whole cell lysates,
Lane 3: human HepG2 whole cell lysates,
Lane 4: human SK-OV-3 whole cell lysates,
Lane 5: human PC-3 whole cell lysates,
Lane 6: human HEK293 whole cell lysates,
Lane 7: rat RH35 whole cell lysates,
Lane 8: mouse HEPA1-6 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RENT1/hUPF1 antigen affinity purified polyclonal antibody (Catalog # PB9842) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for RENT1/hUPF1 at approximately 140 kDa. The expected band size for RENT1/hUPF1 is at 124 kDa.
Click image to see more details
Figure 2. IHC analysis of RENT1/hUPF1 using anti-RENT1/hUPF1 antibody (PB9842).
RENT1/hUPF1 was detected in a paraffin-embedded section of mouse intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-RENT1/hUPF1 Antibody (PB9842) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of RENT1/hUPF1 using anti-RENT1/hUPF1 antibody (PB9842).
RENT1/hUPF1 was detected in a paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-RENT1/hUPF1 Antibody (PB9842) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of RENT1/hUPF1 using anti-RENT1/hUPF1 antibody (PB9842).
RENT1/hUPF1 was detected in a paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-RENT1/hUPF1 Antibody (PB9842) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. Flow Cytometry analysis of PC-3 cells using anti-RENT1/hUPF1 antibody (PB9842).
Overlay histogram showing PC-3 cells stained with PB9842 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-RENT1/hUPF1 Antibody (PB9842,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Click image to see more details
Figure 6. IF analysis of RENT1/hUPF1 using anti-RENT1/hUPF1 antibody (PB9842).
RENT1/hUPF1 was detected in immunocytochemical section of A431 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-RENT1/hUPF1 Antibody (PB9842) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For UPF1 (Source: Uniprot.org, NCBI)
Gene Name
UPF1
Full Name
Regulator of nonsense transcripts 1
Weight
124345 MW
Superfamily
DNA2/NAM7 helicase family
Alternative Names
Regulator of nonsense transcripts 1;3.6.4.-;ATP-dependent helicase RENT1;Nonsense mRNA reducing factor 1;NORF1;Up-frameshift suppressor 1 homolog;hUpf1;UPF1;KIAA0221, RENT1; UPF1 HUPF1, NORF1, RENT1, pNORF1, smg-2 UPF1 RNA helicase and ATPase regulator of nonsense transcripts 1|ATP-dependent helicase RENT1|UPF1 regulator of nonsense transcripts homolog|delta helicase|nonsense mRNA reducing factor 1|smg-2 homolog, nonsense mediated mRNA decay factor|up-frameshift mutation 1 homolog|up-frameshift suppressor 1 homolog|yeast Upf1p homolog
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on UPF1, check out the UPF1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for UPF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-RENT1/hUPF1 Antibody Picoband® (PB9842)
Hello CJ!
No publications found for PB9842
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-RENT1/hUPF1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-RENT1/hUPF1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-RENT1/hUPF1 Antibody Picoband®
Question
Will PB9842 anti-RENT1/hUPF1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-04-27
Answer
You can see on the product datasheet, PB9842 anti-RENT1/hUPF1 antibody as been validated on IF. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-04-27
Question
We ordered your anti-RENT1/hUPF1 antibody for Flow Cytometry on bone marrow in the past. I am using human, and We want to use the antibody for WB next. We need examining bone marrow as well as cervix carcinoma erythroleukemia in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?
Verified Customer
Verified customer
Asked: 2020-02-24
Answer
I viewed the website and datasheets of our anti-RENT1/hUPF1 antibody and it seems that PB9842 has been validated on human in both Flow Cytometry and WB. Thus PB9842 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2020-02-24
Question
We were satisfied with the WB result of your anti-RENT1/hUPF1 antibody. However we have seen positive staining in liver cytoplasm. cytoplasm using this antibody. Is that expected? Could you tell me where is UPF1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-01-14
Answer
From what I have seen in literature, liver does express UPF1. Generally UPF1 expresses in cytoplasm. cytoplasm, p-body. nucleus. Regarding which tissues have UPF1 expression, here are a few articles citing expression in various tissues:
Bone marrow, Pubmed ID: 9039502
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Embryonic kidney, Pubmed ID: 17525332
Heart, Pubmed ID: 8855285
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Uterus, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2020-01-14
Question
We are currently using anti-RENT1/hUPF1 antibody PB9842 for mouse tissue, and we are content with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2019-11-28
Answer
The anti-RENT1/hUPF1 antibody (PB9842) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-11-28
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cerebellar hemisphere using anti-RENT1/hUPF1 antibody PB9842. Let me know if you need anything else.
J. Wu
Verified customer
Asked: 2019-10-17
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-10-17
Question
We want using your anti-RENT1/hUPF1 antibody for cellular response to lipopolysaccharide studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-09-12
Answer
I appreciate your inquiry. This PB9842 anti-RENT1/hUPF1 antibody is tested on rat pancreas tissue, tissue lysate. It is guaranteed to work for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-09-12
Question
We have been able to see staining in mouse cervix carcinoma. Any tips? Is anti-RENT1/hUPF1 antibody supposed to stain cervix carcinoma positively?
Verified Customer
Verified customer
Asked: 2019-09-02
Answer
From what I have seen in literature cervix carcinoma does express UPF1. From what I have seen in Uniprot.org, UPF1 is expressed in cerebellar hemisphere, heart, bone marrow, uterus, cervix carcinoma, embryonic kidney, leukemic t-cell, cervix carcinoma erythroleukemia, liver, colon carcinoma, among other tissues. Regarding which tissues have UPF1 expression, here are a few articles citing expression in various tissues:
Bone marrow, Pubmed ID: 9039502
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Embryonic kidney, Pubmed ID: 17525332
Heart, Pubmed ID: 8855285
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Uterus, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-09-02
Question
I see that the anti-RENT1/hUPF1 antibody PB9842 works with IF, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-09-02
Answer
You can find protocols for IF on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-09-02
Question
I am looking for to test anti-RENT1/hUPF1 antibody PB9842 on rat cerebellar hemisphere for research purposes, then I may be interested in using anti-RENT1/hUPF1 antibody PB9842 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-07-04
Answer
The products we sell, including anti-RENT1/hUPF1 antibody PB9842, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-07-04
Question
I was wanting to use your anti-RENT1/hUPF1 antibody for IF for rat cerebellar hemisphere on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat cerebellar hemisphere identification?
Verified Customer
Verified customer
Asked: 2019-03-07
Answer
It shows on the product datasheet, PB9842 anti-RENT1/hUPF1 antibody has been validated for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat cerebellar hemisphere in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-03-07
Question
Would anti-RENT1/hUPF1 antibody PB9842 work for IF with cerebellar hemisphere?
Verified Customer
Verified customer
Asked: 2018-05-30
Answer
According to the expression profile of cerebellar hemisphere, UPF1 is highly expressed in cerebellar hemisphere. So, it is likely that anti-RENT1/hUPF1 antibody PB9842 will work for IF with cerebellar hemisphere.
Boster Scientific Support
Answered: 2018-05-30
Question
I have a question about product PB9842, anti-RENT1/hUPF1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-04-26
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9842 anti-RENT1/hUPF1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-04-26
Question
Is a blocking peptide available for product anti-RENT1/hUPF1 antibody (PB9842)?
O. Patel
Verified customer
Asked: 2017-08-11
Answer
We do provide the blocking peptide for product anti-RENT1/hUPF1 antibody (PB9842). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-08-11
Question
Do you have a BSA free version of anti-RENT1/hUPF1 antibody PB9842 available?
F. Patel
Verified customer
Asked: 2017-06-12
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-RENT1/hUPF1 antibody PB9842 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-06-12
Question
Is this PB9842 anti-RENT1/hUPF1 antibody reactive to the isotypes of UPF1?
S. Gonzalez
Verified customer
Asked: 2016-05-26
Answer
The immunogen of PB9842 anti-RENT1/hUPF1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2016-05-26
Question
See below the WB image, lot number and protocol we used for cerebellar hemisphere using anti-RENT1/hUPF1 antibody PB9842. Please let me know if you require anything else.
G. Johnson
Verified customer
Asked: 2014-04-22
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2014-04-22