Anti-RENT1/hUPF1 Antibody Picoband®

RENT1/UPF1/hUPF1 antibody

Boster Bio Anti-RENT1/hUPF1 Antibody Picoband® catalog # PB9842. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9842
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-RENT1/hUPF1 Antibody Picoband®

View all RENT1/UPF1/hUPF1 Antibodies

SKU/Catalog Number

PB9842

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-RENT1/hUPF1 Antibody Picoband® catalog # PB9842. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-RENT1/hUPF1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9842)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9842 is reactive to UPF1 in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

140 kDa

Calculated molecular weight

124345 MW

Background of RENT1/UPF1/hUPF1

Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9842 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: human Hela whole cell, human Raji whole cell, human HepG2 whole cell, human SK-OV-3 whole cell, human PC-3 whole cell, human HEK293 whole cell, rat RH35 whole cell, mouse HEPA1-6 whole cell
IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue
ICC/IF: A431 cell
FCM: PC-3 cell

Validation Images & Assay Conditions

Gene/Protein Information For UPF1 (Source: Uniprot.org, NCBI)

Gene Name

UPF1

Full Name

Regulator of nonsense transcripts 1

Weight

124345 MW

Superfamily

DNA2/NAM7 helicase family

Alternative Names

Regulator of nonsense transcripts 1;3.6.4.-;ATP-dependent helicase RENT1;Nonsense mRNA reducing factor 1;NORF1;Up-frameshift suppressor 1 homolog;hUpf1;UPF1;KIAA0221, RENT1; UPF1 HUPF1, NORF1, RENT1, pNORF1, smg-2 UPF1 RNA helicase and ATPase regulator of nonsense transcripts 1|ATP-dependent helicase RENT1|UPF1 regulator of nonsense transcripts homolog|delta helicase|nonsense mRNA reducing factor 1|smg-2 homolog, nonsense mediated mRNA decay factor|up-frameshift mutation 1 homolog|up-frameshift suppressor 1 homolog|yeast Upf1p homolog

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on UPF1, check out the UPF1 Infographic

UPF1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UPF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9842

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-RENT1/hUPF1 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-RENT1/hUPF1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-RENT1/hUPF1 Antibody Picoband®

Question

Will PB9842 anti-RENT1/hUPF1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-04-27

Answer

You can see on the product datasheet, PB9842 anti-RENT1/hUPF1 antibody as been validated on IF. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-04-27

Question

We ordered your anti-RENT1/hUPF1 antibody for Flow Cytometry on bone marrow in the past. I am using human, and We want to use the antibody for WB next. We need examining bone marrow as well as cervix carcinoma erythroleukemia in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2020-02-24

Answer

I viewed the website and datasheets of our anti-RENT1/hUPF1 antibody and it seems that PB9842 has been validated on human in both Flow Cytometry and WB. Thus PB9842 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-02-24

Question

We were satisfied with the WB result of your anti-RENT1/hUPF1 antibody. However we have seen positive staining in liver cytoplasm. cytoplasm using this antibody. Is that expected? Could you tell me where is UPF1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-01-14

Answer

From what I have seen in literature, liver does express UPF1. Generally UPF1 expresses in cytoplasm. cytoplasm, p-body. nucleus. Regarding which tissues have UPF1 expression, here are a few articles citing expression in various tissues:
Bone marrow, Pubmed ID: 9039502
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Embryonic kidney, Pubmed ID: 17525332
Heart, Pubmed ID: 8855285
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Uterus, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-01-14

Question

We are currently using anti-RENT1/hUPF1 antibody PB9842 for mouse tissue, and we are content with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2019-11-28

Answer

The anti-RENT1/hUPF1 antibody (PB9842) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-11-28

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cerebellar hemisphere using anti-RENT1/hUPF1 antibody PB9842. Let me know if you need anything else.

J. Wu

Verified customer

Asked: 2019-10-17

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-17

Question

We want using your anti-RENT1/hUPF1 antibody for cellular response to lipopolysaccharide studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-09-12

Answer

I appreciate your inquiry. This PB9842 anti-RENT1/hUPF1 antibody is tested on rat pancreas tissue, tissue lysate. It is guaranteed to work for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-09-12

Question

We have been able to see staining in mouse cervix carcinoma. Any tips? Is anti-RENT1/hUPF1 antibody supposed to stain cervix carcinoma positively?

Verified Customer

Verified customer

Asked: 2019-09-02

Answer

From what I have seen in literature cervix carcinoma does express UPF1. From what I have seen in Uniprot.org, UPF1 is expressed in cerebellar hemisphere, heart, bone marrow, uterus, cervix carcinoma, embryonic kidney, leukemic t-cell, cervix carcinoma erythroleukemia, liver, colon carcinoma, among other tissues. Regarding which tissues have UPF1 expression, here are a few articles citing expression in various tissues:
Bone marrow, Pubmed ID: 9039502
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Embryonic kidney, Pubmed ID: 17525332
Heart, Pubmed ID: 8855285
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Uterus, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-09-02

Question

I see that the anti-RENT1/hUPF1 antibody PB9842 works with IF, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-09-02

Answer

You can find protocols for IF on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-09-02

Question

I am looking for to test anti-RENT1/hUPF1 antibody PB9842 on rat cerebellar hemisphere for research purposes, then I may be interested in using anti-RENT1/hUPF1 antibody PB9842 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-07-04

Answer

The products we sell, including anti-RENT1/hUPF1 antibody PB9842, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-07-04

Question

I was wanting to use your anti-RENT1/hUPF1 antibody for IF for rat cerebellar hemisphere on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat cerebellar hemisphere identification?

Verified Customer

Verified customer

Asked: 2019-03-07

Answer

It shows on the product datasheet, PB9842 anti-RENT1/hUPF1 antibody has been validated for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat cerebellar hemisphere in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-03-07

Question

Would anti-RENT1/hUPF1 antibody PB9842 work for IF with cerebellar hemisphere?

Verified Customer

Verified customer

Asked: 2018-05-30

Answer

According to the expression profile of cerebellar hemisphere, UPF1 is highly expressed in cerebellar hemisphere. So, it is likely that anti-RENT1/hUPF1 antibody PB9842 will work for IF with cerebellar hemisphere.

Boster Scientific Support

Answered: 2018-05-30

Question

I have a question about product PB9842, anti-RENT1/hUPF1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-04-26

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9842 anti-RENT1/hUPF1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-04-26

Question

Is a blocking peptide available for product anti-RENT1/hUPF1 antibody (PB9842)?

O. Patel

Verified customer

Asked: 2017-08-11

Answer

We do provide the blocking peptide for product anti-RENT1/hUPF1 antibody (PB9842). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-08-11

Question

Do you have a BSA free version of anti-RENT1/hUPF1 antibody PB9842 available?

F. Patel

Verified customer

Asked: 2017-06-12

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-RENT1/hUPF1 antibody PB9842 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-06-12

Question

Is this PB9842 anti-RENT1/hUPF1 antibody reactive to the isotypes of UPF1?

S. Gonzalez

Verified customer

Asked: 2016-05-26

Answer

The immunogen of PB9842 anti-RENT1/hUPF1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-05-26

Question

See below the WB image, lot number and protocol we used for cerebellar hemisphere using anti-RENT1/hUPF1 antibody PB9842. Please let me know if you require anything else.

G. Johnson

Verified customer

Asked: 2014-04-22

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2014-04-22

Order DetailsPrice
PB9842

100μg

$370
PB9842-10ug

10μg sample (liquid)

$99
PB9842-Biotin

100 μg Biotin conjugated

$570
PB9842-Cy3

100 μg Cy3 conjugated

$570
PB9842-Dylight488

100 μg Dylight488 conjugated

$570
PB9842-Dylight550

100 μg Dylight550 conjugated

$570
PB9842-Dylight594

100 μg Dylight594 conjugated

$570
PB9842-FITC

100 μg FITC conjugated

$570
PB9842-HRP

100 μg HRP conjugated

$570
PB9842-APC

100 μg APC conjugated

$670
PB9842-PE

100 μg PE conjugated

$670
PB9842-iFluor647

100 μg iFluor647 conjugated

$670
PB9842-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9842
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product