Click image to see more details
Product Info Summary
| SKU: | PB10088 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband®
SKU/Catalog Number
PB10088
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband® catalog # PB10088. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10088)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human PSMA2, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB10088 is reactive to PSMA2 in Human, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
26 kDa
Calculated molecular weight
25899 MW
Background of PSMA2
Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB10088 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Positive Control
WB: rat testis tissue, MCF-7 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of PSMA2 using anti-PSMA2 antibody (PB10088).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat testis tissue lysates,
Lane 2: MCF-7 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PSMA2 antigen affinity purified polyclonal antibody (Catalog # PB10088) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PSMA2 at approximately 26 kDa. The expected band size for PSMA2 is at 26 kDa.
Protein Target Info & Infographic
Gene/Protein Information For PSMA2 (Source: Uniprot.org, NCBI)
Gene Name
PSMA2
Full Name
Proteasome subunit alpha type-2
Weight
25899 MW
Superfamily
peptidase T1A family
Alternative Names
Proteasome subunit alpha type-2;3.4.25.1;Macropain subunit C3;Multicatalytic endopeptidase complex subunit C3;Proteasome component C3;PSMA2;HC3, PSC3; PSMA2 HC3, MU, PMSA2, PSC2 proteasome 20S subunit alpha 2 proteasome subunit alpha type-2|macropain subunit C3|multicatalytic endopeptidase complex subunit C3|proteasome (prosome, macropain) subunit, alpha type, 2|proteasome component C3|proteasome subunit HC3|proteasome subunit alpha 2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PSMA2, check out the PSMA2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PSMA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband® (PB10088)
Hello CJ!
No publications found for PB10088
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband®
Question
I was wanting to use your anti-Proteasome 20S alpha 2/PSMA2 antibody for WB for human kidney on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human kidney identification?
Verified Customer
Verified customer
Asked: 2019-12-04
Answer
You can see on the product datasheet, PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody has been validated for WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human kidney in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-12-04
Question
My question regarding product PB10088, anti-Proteasome 20S alpha 2/PSMA2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-10-21
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-10-21
Question
Is this PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody reactive to the isotypes of PSMA2?
H. Jones
Verified customer
Asked: 2019-04-19
Answer
The immunogen of PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody is A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYT Q), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-04-19
Question
Will anti-Proteasome 20S alpha 2/PSMA2 antibody PB10088 work on feline WB with brain cajal-retzius cell?
Verified Customer
Verified customer
Asked: 2019-03-27
Answer
Our lab technicians have not tested anti-Proteasome 20S alpha 2/PSMA2 antibody PB10088 on feline. You can run a BLAST between feline and the immunogen sequence of anti-Proteasome 20S alpha 2/PSMA2 antibody PB10088 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline brain cajal-retzius cell in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-03-27
Question
Will PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
S. Carter
Verified customer
Asked: 2018-06-04
Answer
As indicated on the product datasheet, PB10088 anti-Proteasome 20S alpha 2/PSMA2 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-06-04
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for kidney using anti-Proteasome 20S alpha 2/PSMA2 antibody PB10088. Let me know if you need anything else.
S. Carter
Verified customer
Asked: 2016-05-13
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-05-13
Question
We are currently using anti-Proteasome 20S alpha 2/PSMA2 antibody PB10088 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on canine tissues as well?
M. Edwards
Verified customer
Asked: 2015-08-28
Answer
The anti-Proteasome 20S alpha 2/PSMA2 antibody (PB10088) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2015-08-28
