Anti-Peptide YY/PYY Antibody Picoband™

Peptide YY antibody

Boster Bio Anti-Peptide YY/PYY Antibody Picoband™ catalog # A04223-1. Tested in IHC applications. This antibody reacts with Human.

Product Info Summary

SKU: A04223-1
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: IHC

Product Name

Anti-Peptide YY/PYY Antibody Picoband™

View all Peptide YY Antibodies

SKU/Catalog Number

A04223-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Peptide YY/PYY Antibody Picoband™ catalog # A04223-1. Tested in IHC applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Peptide YY/PYY Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04223-1)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Peptide YY/PYY, which shares 91.7% amino acid (aa) sequence identity with both mouse and rat Peptide YY/PYY.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A04223-1 is reactive to PYY in Human

Applications

A04223-1 is guaranteed for IHC Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

87794 MW

Background of Peptide YY

Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa.

Take control of your experiments with tailored peptides. Our custom peptide synthesis allows you to take full control of your research objectives. Partner with us to access an extensive range of modifications and optimize your peptide properties for ultimate success.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For PYY (Source: Uniprot.org, NCBI)

Gene Name

PYY

Full Name

Peptide YY

Weight

87794 MW

Superfamily

NPY family

Alternative Names

Peptide tyrosine tyrosine; Peptide YY; Peptide-YY; PYY; PYY1; PYY-I PYY PYY-I1, PYY peptide YY peptide YY|peptide tyrosine tyrosine|prepro-PYY

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on PYY, check out the PYY Infographic

PYY infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PYY: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A04223-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Peptide YY/PYY Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Peptide YY/PYY Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

12 Customer Q&As for Anti-Peptide YY/PYY Antibody Picoband™

Question

My question regarding product A04223-1, anti-Peptide YY/PYY antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-04-21

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04223-1 anti-Peptide YY/PYY antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-04-21

Question

Would A04223-1 anti-Peptide YY/PYY antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

D. Williams

Verified customer

Asked: 2019-11-22

Answer

You can see on the product datasheet, A04223-1 anti-Peptide YY/PYY antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-11-22

Question

Is a blocking peptide available for product anti-Peptide YY/PYY antibody (A04223-1)?

Verified Customer

Verified customer

Asked: 2019-09-24

Answer

We do provide the blocking peptide for product anti-Peptide YY/PYY antibody (A04223-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-09-24

Question

Is this A04223-1 anti-Peptide YY/PYY antibody reactive to the isotypes of PYY?

Verified Customer

Verified customer

Asked: 2019-08-13

Answer

The immunogen of A04223-1 anti-Peptide YY/PYY antibody is A synthetic peptide corresponding to a sequence of human Peptide YY/PYY (YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-13

Question

Do you have a BSA free version of anti-Peptide YY/PYY antibody A04223-1 available?

Verified Customer

Verified customer

Asked: 2019-05-23

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Peptide YY/PYY antibody A04223-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-05-23

Question

I was wanting to use your anti-Peptide YY/PYY antibody for IHC for human colon mucosa on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human colon mucosa identification?

Verified Customer

Verified customer

Asked: 2019-05-14

Answer

As indicated on the product datasheet, A04223-1 anti-Peptide YY/PYY antibody has been tested for IHC on human tissues. We have an innovator award program that if you test this antibody and show it works in human colon mucosa in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-05-14

Question

I have attached the WB image, lot number and protocol we used for colon mucosa using anti-Peptide YY/PYY antibody A04223-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-11-23

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-11-23

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for colon mucosa using anti-Peptide YY/PYY antibody A04223-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-11-12

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-11-12

Question

Does anti-Peptide YY/PYY antibody A04223-1 work for IHC with colon mucosa?

Verified Customer

Verified customer

Asked: 2018-04-09

Answer

According to the expression profile of colon mucosa, PYY is highly expressed in colon mucosa. So, it is likely that anti-Peptide YY/PYY antibody A04223-1 will work for IHC with colon mucosa.

Boster Scientific Support

Answered: 2018-04-09

Question

I see that the anti-Peptide YY/PYY antibody A04223-1 works with IHC, what is the protocol used to produce the result images on the product page?

R. Jones

Verified customer

Asked: 2016-11-02

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2016-11-02

Question

We are interested in to test anti-Peptide YY/PYY antibody A04223-1 on human colon mucosa for research purposes, then I may be interested in using anti-Peptide YY/PYY antibody A04223-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

F. Mitchell

Verified customer

Asked: 2015-10-08

Answer

The products we sell, including anti-Peptide YY/PYY antibody A04223-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-10-08

Question

Will anti-Peptide YY/PYY antibody A04223-1 work on bovine IHC with mucosa of transverse colon?

D. Jackson

Verified customer

Asked: 2014-12-25

Answer

Our lab technicians have not tested anti-Peptide YY/PYY antibody A04223-1 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-Peptide YY/PYY antibody A04223-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine mucosa of transverse colon in IHC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2014-12-25

Order DetailsPrice
A04223-1

100μg

$370
A04223-1-10ug

10μg sample (liquid)

$99
A04223-1-Biotin

100 μg Biotin conjugated

$570
A04223-1-Cy3

100 μg Cy3 conjugated

$570
A04223-1-Dylight488

100 μg Dylight488 conjugated

$570
A04223-1-Dylight550

100 μg Dylight550 conjugated

$570
A04223-1-Dylight594

100 μg Dylight594 conjugated

$570
A04223-1-FITC

100 μg FITC conjugated

$570
A04223-1-HRP

100 μg HRP conjugated

$570
A04223-1-APC

100 μg APC conjugated

$670
A04223-1-PE

100 μg PE conjugated

$670
A04223-1-iFluor647

100 μg iFluor647 conjugated

$670
A04223-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A04223-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.