Product Info Summary
SKU: | PB9344 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Otx2 Antibody Picoband®
SKU/Catalog Number
PB9344
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Otx2 Antibody Picoband® catalog # PB9344. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Otx2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9344)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2, identical to the related mouse sequence.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9344 is reactive to OTX2 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
32 kDa
Calculated molecular weight
31636 MW
Background of OTX2
OTX2 is also known as CPHD6 or MCOPS5. This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9344 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: COLO320 Whole Cell
Validation Images & Assay Conditions
Click image to see more details
Anti-Otx2 Picoband antibody, PB9344, Western blotting
All lanes: Anti Otx2 (PB9344) at 0.5ug/ml
WB: COLO320 Whole Cell Lysate at 40ug
Predicted bind size: 32KD
Observed bind size: 32KD
Protein Target Info & Infographic
Gene/Protein Information For OTX2 (Source: Uniprot.org, NCBI)
Gene Name
OTX2
Full Name
Homeobox protein OTX2
Weight
31636 MW
Superfamily
paired homeobox family
Alternative Names
Homeobox protein OTX2;Orthodenticle homolog 2;OTX2; OTX2 CPHD6, MCOPS5 orthodenticle homeobox 2 homeobox protein OTX2|orthodenticle homolog 2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on OTX2, check out the OTX2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for OTX2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Otx2 Antibody Picoband® (PB9344)
Hello CJ!
No publications found for PB9344
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Otx2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Otx2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-Otx2 Antibody Picoband®
Question
I was wanting to use your anti-Otx2 antibody for WB for human eye on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human eye identification?
Verified Customer
Verified customer
Asked: 2020-03-06
Answer
You can see on the product datasheet, PB9344 anti-Otx2 antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human eye in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-03-06
Question
We want to test anti-Otx2 antibody PB9344 on human eye for research purposes, then I may be interested in using anti-Otx2 antibody PB9344 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-05-10
Answer
The products we sell, including anti-Otx2 antibody PB9344, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-05-10
Question
We are currently using anti-Otx2 antibody PB9344 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2018-04-03
Answer
The anti-Otx2 antibody (PB9344) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-04-03
Question
Is this PB9344 anti-Otx2 antibody reactive to the isotypes of OTX2?
B. Jones
Verified customer
Asked: 2015-09-15
Answer
The immunogen of PB9344 anti-Otx2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2015-09-15