Anti-Otx2 Antibody Picoband®

OTX2 antibody

Boster Bio Anti-Otx2 Antibody Picoband® catalog # PB9344. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9344
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-Otx2 Antibody Picoband®

View all OTX2 Antibodies

SKU/Catalog Number

PB9344

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Otx2 Antibody Picoband® catalog # PB9344. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Otx2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9344)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2, identical to the related mouse sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9344 is reactive to OTX2 in Human

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

32 kDa

Calculated molecular weight

31636 MW

Background of OTX2

OTX2 is also known as CPHD6 or MCOPS5. This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9344 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Positive Control

WB: COLO320 Whole Cell

Validation Images & Assay Conditions

Gene/Protein Information For OTX2 (Source: Uniprot.org, NCBI)

Gene Name

OTX2

Full Name

Homeobox protein OTX2

Weight

31636 MW

Superfamily

paired homeobox family

Alternative Names

Homeobox protein OTX2;Orthodenticle homolog 2;OTX2; OTX2 CPHD6, MCOPS5 orthodenticle homeobox 2 homeobox protein OTX2|orthodenticle homolog 2

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on OTX2, check out the OTX2 Infographic

OTX2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for OTX2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9344

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Otx2 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Otx2 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Otx2 Antibody Picoband®

Question

I was wanting to use your anti-Otx2 antibody for WB for human eye on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human eye identification?

Verified Customer

Verified customer

Asked: 2020-03-06

Answer

You can see on the product datasheet, PB9344 anti-Otx2 antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human eye in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-03-06

Question

We want to test anti-Otx2 antibody PB9344 on human eye for research purposes, then I may be interested in using anti-Otx2 antibody PB9344 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-05-10

Answer

The products we sell, including anti-Otx2 antibody PB9344, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-05-10

Question

We are currently using anti-Otx2 antibody PB9344 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2018-04-03

Answer

The anti-Otx2 antibody (PB9344) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-04-03

Question

Is this PB9344 anti-Otx2 antibody reactive to the isotypes of OTX2?

B. Jones

Verified customer

Asked: 2015-09-15

Answer

The immunogen of PB9344 anti-Otx2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2015-09-15

Order DetailsPrice
PB9344

100μg

$370
PB9344-10ug

10μg sample (liquid)

$99
PB9344-Biotin

100 μg Biotin conjugated

$570
PB9344-Cy3

100 μg Cy3 conjugated

$570
PB9344-Dylight488

100 μg Dylight488 conjugated

$570
PB9344-Dylight550

100 μg Dylight550 conjugated

$570
PB9344-Dylight594

100 μg Dylight594 conjugated

$570
PB9344-FITC

100 μg FITC conjugated

$570
PB9344-HRP

100 μg HRP conjugated

$570
PB9344-APC

100 μg APC conjugated

$670
PB9344-PE

100 μg PE conjugated

$670
PB9344-iFluor647

100 μg iFluor647 conjugated

$670
PB9344-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9344
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.