Product Info Summary
SKU: | A01808 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-NMDAR1/GRIN1 Antibody Picoband®
SKU/Catalog Number
A01808
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-NMDAR1/GRIN1 Antibody Picoband® catalog # A01808. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-NMDAR1/GRIN1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01808)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human NMDAR1, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01808 is reactive to GRIN1 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
120 kDa
Calculated molecular weight
105.373kDa
Background of GRIN1
Glutamate [NMDA] receptor subunit zeta-1 is a protein that in humans is encoded by the GRIN1 gene. The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01808 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: rat brain tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of NMDAR1 using anti-NMDAR1 antibody (A01808).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-NMDAR1 antigen affinity purified polyclonal antibody (Catalog # A01808) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for NMDAR1 at approximately 120KD. The expected band size for NMDAR1 is at 105KD.
Protein Target Info & Infographic
Gene/Protein Information For GRIN1 (Source: Uniprot.org, NCBI)
Gene Name
GRIN1
Full Name
Glutamate receptor ionotropic, NMDA 1
Weight
105.373kDa
Superfamily
glutamate-gated ion channel (TC 1.A.10.1) family
Alternative Names
Glutamate receptor ionotropic, NMDA 1; GluN1; Glutamate [NMDA] receptor subunit zeta-1; N-methyl-D-aspartate receptor subunit NR1; NMD-R1; GRIN1; NMDAR1 GRIN1 GluN1, MRD8, NDHMSD, NDHMSR, NMD-R1, NMDA1, NMDAR1, NR1 glutamate ionotropic receptor NMDA type subunit 1 glutamate receptor ionotropic, NMDA 1|N-methyl-D-aspartate receptor channel, subunit zeta-1|N-methyl-D-aspartate receptor subunit NR1|glutamate [NMDA] receptor subunit zeta-1|glutamate receptor, ionotropic, N-methyl D-aspartate 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on GRIN1, check out the GRIN1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for GRIN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-NMDAR1/GRIN1 Antibody Picoband® (A01808)
Hello CJ!
A01808 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Mechanisms responsible for the effect of median nerve electrical stimulation on traumatic brain injury-induced coma: orexin-A-mediated N-methyl-D-aspartate receptor subunit NR1 upregulation
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-NMDAR1/GRIN1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-NMDAR1/GRIN1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-NMDAR1/GRIN1 Antibody Picoband®
Question
I am interested in to test anti-NMDAR1/GRIN1 antibody A01808 on mouse brain for research purposes, then I may be interested in using anti-NMDAR1/GRIN1 antibody A01808 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-04-16
Answer
The products we sell, including anti-NMDAR1/GRIN1 antibody A01808, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-04-16
Question
We have been able to see staining in human brain. Do you have any suggestions? Is anti-NMDAR1/GRIN1 antibody supposed to stain brain positively?
Verified Customer
Verified customer
Asked: 2020-03-10
Answer
According to literature brain does express GRIN1. According to Uniprot.org, GRIN1 is expressed in anterior cingulate cortex, brain, cerebellum hippocampus, among other tissues. Regarding which tissues have GRIN1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 7685113, 8406025
Cerebellum, and Hippocampus, Pubmed ID: 7926821
Boster Scientific Support
Answered: 2020-03-10
Question
My colleagues were happy with the WB result of your anti-NMDAR1/GRIN1 antibody. However we have been able to see positive staining in cerebellum hippocampus cell membrane using this antibody. Is that expected? Could you tell me where is GRIN1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-02-06
Answer
From literature, cerebellum hippocampus does express GRIN1. Generally GRIN1 expresses in cell membrane. Regarding which tissues have GRIN1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 7685113, 8406025
Cerebellum, and Hippocampus, Pubmed ID: 7926821
Boster Scientific Support
Answered: 2020-02-06
Question
Can you help my question with product A01808, anti-NMDAR1/GRIN1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-12-13
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01808 anti-NMDAR1/GRIN1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-12-13
Question
Is a blocking peptide available for product anti-NMDAR1/GRIN1 antibody (A01808)?
Verified Customer
Verified customer
Asked: 2019-12-13
Answer
We do provide the blocking peptide for product anti-NMDAR1/GRIN1 antibody (A01808). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-13
Question
I see that the anti-NMDAR1/GRIN1 antibody A01808 works with WB, what is the protocol used to produce the result images on the product page?
G. Jones
Verified customer
Asked: 2019-12-13
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-12-13
Question
Would anti-NMDAR1/GRIN1 antibody A01808 work for WB with brain?
Verified Customer
Verified customer
Asked: 2019-11-06
Answer
According to the expression profile of brain, GRIN1 is highly expressed in brain. So, it is likely that anti-NMDAR1/GRIN1 antibody A01808 will work for WB with brain.
Boster Scientific Support
Answered: 2019-11-06
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-NMDAR1/GRIN1 antibody A01808. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-09-27
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-09-27
Question
Will A01808 anti-NMDAR1/GRIN1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-07-04
Answer
As indicated on the product datasheet, A01808 anti-NMDAR1/GRIN1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-07-04
Question
We need using your anti-NMDAR1/GRIN1 antibody for glutamatergic studies. Has this antibody been tested with western blotting on rat brain tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-05-27
Answer
I appreciate your inquiry. This A01808 anti-NMDAR1/GRIN1 antibody is tested on rat brain tissue, tissue lysate. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-05-27
Question
Do you have a BSA free version of anti-NMDAR1/GRIN1 antibody A01808 available?
Verified Customer
Verified customer
Asked: 2018-10-22
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-NMDAR1/GRIN1 antibody A01808 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-10-22
Question
We are currently using anti-NMDAR1/GRIN1 antibody A01808 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on monkey tissues as well?
Verified Customer
Verified customer
Asked: 2018-05-23
Answer
The anti-NMDAR1/GRIN1 antibody (A01808) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-05-23
Question
Is this A01808 anti-NMDAR1/GRIN1 antibody reactive to the isotypes of GRIN1?
A. Rodriguez
Verified customer
Asked: 2014-12-15
Answer
The immunogen of A01808 anti-NMDAR1/GRIN1 antibody is A synthetic peptide corresponding to a sequence of human NMDAR1 (FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-12-15
Question
I was wanting to use your anti-NMDAR1/GRIN1 antibody for WB for mouse brain on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse brain identification?
T. Roberts
Verified customer
Asked: 2013-08-19
Answer
As indicated on the product datasheet, A01808 anti-NMDAR1/GRIN1 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-08-19
Question
See attached the WB image, lot number and protocol we used for brain using anti-NMDAR1/GRIN1 antibody A01808. Please let me know if you require anything else.
M. Krishna
Verified customer
Asked: 2013-05-10
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2013-05-10