Click image to see more details
Product Info Summary
| SKU: | A00420 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Monkey |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-MMP13 Antibody Picoband®
SKU/Catalog Number
A00420
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-MMP13 Antibody Picoband® catalog # A00420. Tested in WB applications. This antibody reacts with Human, Monkey. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-MMP13 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00420)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13, different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00420 is reactive to MMP13 in Human, Monkey
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
54 kDa
Calculated molecular weight
53820 MW
Background of MMP-13
Collagenase 3 is an enzyme that in humans is encoded by the MMP13 gene. This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00420 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Monkey
Positive Control
WB: HELA whole cell, human PC-3 whole cell, human U20S whole cell, human A549 whole cell, human HEK293 whole cellRabbit IgG(55KD), Marker 1113, human MDA-MB-453 whole cell, monkey COS-7 whole cell, rat lung tissue, mouse lung tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of MMP13 using anti-MMP13 antibody (A00420).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: HELA whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MMP13 antigen affinity purified polyclonal antibody (Catalog # A00420) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for MMP13 at approximately 54KD. The expected band size for MMP13 is at 54KD.
Click image to see more details
Figure 2. Western blot analysis of MMP13 using anti-MMP13 antibody (A00420).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human PC-3 whole cell lysates,
Lane 2: human U20S whole cell lysates,
Lane 3: human A549 whole cell lysates,
Lane 4: human HEK293 whole cell lysates.
Lane 5: Rabbit IgG(55KD),
Lane 6: Marker 1113
Lane 7: human MDA-MB-453 whole cell lysates,
Lane 8: monkey COS-7 whole cell lysates,
Lane 9: rat lung tissue lysates,
Lane 10: mouse lung tissue lysates,
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MMP13 antigen affinity purified polyclonal antibody (Catalog # A00420) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for MMP13 at approximately 54KD. The expected band size for MMP13 is at 54KD.
Protein Target Info & Infographic
Gene/Protein Information For MMP13 (Source: Uniprot.org, NCBI)
Gene Name
MMP13
Full Name
Collagenase 3
Weight
53820 MW
Superfamily
peptidase M10A family
Alternative Names
Collagenase 3;3.4.24.-;Matrix metalloproteinase-13;MMP-13;MMP13; MMP13 CLG3, MANDP1, MDST, MMP-13 matrix metallopeptidase 13 collagenase 3|matrix metalloproteinase 13 (collagenase 3)
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on MMP13, check out the MMP13 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MMP13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-MMP13 Antibody Picoband® (A00420)
Hello CJ!
A00420 has been cited in 5 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Chondroprotective effects of ginsenoside Rg1 in human osteoarthritis chondrocytes and a rat model of anterior cruciate ligament transection
Hydrogen sulfide attenuates IL-1%u03B2-induced inflammatory signaling and dysfunction of osteoarthritic chondrocytes
Effects of ultrasound on estradiol level, bone mineral density, bone biomechanics and matrix metalloproteinase-13 expression in ovariectomized rabbits
Protective effects of tumor necrosis factor-? blockade by adalimumab on articular cartilage and subchondral bone in a rat model of osteoarthritis
Huang Gf, Zou J, Shi J, Zhang Dy, Pen Hf, Zhang Q, Gao Y, Wang By. Evid Based Complement Alternat Med. 2014;2014:731395. Doi: 10.1155/2014/731395. Epub 2014 May 27. The Effect Of Electroacupuncture On The Extracellular Matrix Synthesis And Degrada...
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-MMP13 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-MMP13 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-MMP13 Antibody Picoband®
Question
Do you have a BSA free version of anti-MMP13 antibody A00420 available?
Verified Customer
Verified customer
Asked: 2020-04-30
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-MMP13 antibody A00420 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-30
Question
Is this A00420 anti-MMP13 antibody reactive to the isotypes of MMP13?
Verified Customer
Verified customer
Asked: 2020-04-27
Answer
The immunogen of A00420 anti-MMP13 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino aci. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-27
Question
We are currently using anti-MMP13 antibody A00420 for monkey tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, monkey. Is it true that the antibody can work on zebrafish tissues as well?
C. Bhatt
Verified customer
Asked: 2020-02-10
Answer
The anti-MMP13 antibody (A00420) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-02-10
Question
Would A00420 anti-MMP13 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-01-24
Answer
As indicated on the product datasheet, A00420 anti-MMP13 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-01-24
Question
I see that the anti-MMP13 antibody A00420 works with WB, what is the protocol used to produce the result images on the product page?
O. Parker
Verified customer
Asked: 2019-10-29
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-10-29
Question
Is a blocking peptide available for product anti-MMP13 antibody (A00420)?
Verified Customer
Verified customer
Asked: 2019-09-02
Answer
We do provide the blocking peptide for product anti-MMP13 antibody (A00420). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-09-02
Question
My question regarding product A00420, anti-MMP13 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-07-04
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00420 anti-MMP13 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-07-04
Question
We need using your anti-MMP13 antibody for collagen degradation studies. Has this antibody been tested with western blotting on rat lung tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-06-18
Answer
We appreciate your inquiry. This A00420 anti-MMP13 antibody is tested on hela whole cell lysates, human a549, u20s whole cell lysates, a549 whole cell lysates, marker 1113, rat lung tissue, mouse lung tissue. It is guaranteed to work for WB in human, monkey. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-06-18
Question
I was wanting to use to test anti-MMP13 antibody A00420 on monkey esophagus synovium for research purposes, then I may be interested in using anti-MMP13 antibody A00420 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-05-28
Answer
The products we sell, including anti-MMP13 antibody A00420, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-05-28
Question
Will anti-MMP13 antibody A00420 work for WB with esophagus synovium?
Verified Customer
Verified customer
Asked: 2019-05-27
Answer
According to the expression profile of esophagus synovium, MMP13 is highly expressed in esophagus synovium. So, it is likely that anti-MMP13 antibody A00420 will work for WB with esophagus synovium.
Boster Scientific Support
Answered: 2019-05-27
Question
My team were well pleased with the WB result of your anti-MMP13 antibody. However we have seen positive staining in lung extracellular using this antibody. Is that expected? Could you tell me where is MMP13 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-01-15
Answer
According to literature, lung does express MMP13. Generally MMP13 expresses in secreted, extracellular space, extracellular. Regarding which tissues have MMP13 expression, here are a few articles citing expression in various tissues:
Esophagus, and Synovium, Pubmed ID: 14702039
Lung, Pubmed ID: 15489334
Mammary carcinoma, Pubmed ID: 8207000, 9562863
Boster Scientific Support
Answered: 2019-01-15
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for esophagus synovium using anti-MMP13 antibody A00420. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2017-09-21
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-09-21
Question
Please see the WB image, lot number and protocol we used for esophagus synovium using anti-MMP13 antibody A00420. Please let me know if you require anything else.
M. Johnson
Verified customer
Asked: 2015-04-27
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2015-04-27
Question
We have seen staining in human mammary carcinoma. Are there any suggestions? Is anti-MMP13 antibody supposed to stain mammary carcinoma positively?
C. Mangal
Verified customer
Asked: 2014-11-24
Answer
From literature mammary carcinoma does express MMP13. From Uniprot.org, MMP13 is expressed in tibia, mammary carcinoma, esophagus synovium, lung, among other tissues. Regarding which tissues have MMP13 expression, here are a few articles citing expression in various tissues:
Esophagus, and Synovium, Pubmed ID: 14702039
Lung, Pubmed ID: 15489334
Mammary carcinoma, Pubmed ID: 8207000, 9562863
Boster Scientific Support
Answered: 2014-11-24
Question
I was wanting to use your anti-MMP13 antibody for WB for monkey esophagus synovium on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for monkey esophagus synovium identification?
O. Roberts
Verified customer
Asked: 2013-01-18
Answer
As indicated on the product datasheet, A00420 anti-MMP13 antibody has been tested for WB on human, monkey tissues. We have an innovator award program that if you test this antibody and show it works in monkey esophagus synovium in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-01-18
