Click image to see more details
Product Info Summary
| SKU: | PB9724 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-MLH1 Antibody Picoband®
SKU/Catalog Number
PB9724
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-MLH1 Antibody Picoband® catalog # PB9724. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-MLH1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9724)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MLH1, different from the related mouse sequence by three amino acids, and from the related rat sequence by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9724 is reactive to MLH1 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
85 kDa
Calculated molecular weight
84601 MW
Background of MLH1
MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) is a protein that in humans is encoded by the MLH1 gene located on Chromosome 3. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described, but their full-length natures have not been determined.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9724 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: human HEK293 whole cell, human Hela whole cell, human COLO-320 whole cell, human T-47D whole cell, human A549 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of MLH1 using anti-MLH1 antibody (PB9724).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human HEK293 whole cell lysates,
Lane 2: human Hela whole cell lysates,
Lane 3: human COLO-320 whole cell lysates,
Lane 4: human T-47D whole cell lysates,
Lane 5: human A549 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MLH1 antigen affinity purified polyclonal antibody (Catalog # PB9724) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for MLH1 at approximately 85KD. The expected band size for MLH1 is at 85KD.
Protein Target Info & Infographic
Gene/Protein Information For MLH1 (Source: Uniprot.org, NCBI)
Gene Name
MLH1
Full Name
DNA mismatch repair protein Mlh1
Weight
84601 MW
Superfamily
DNA mismatch repair MutL/HexB family
Alternative Names
DNA mismatch repair protein Mlh1;MutL protein homolog 1;MLH1;COCA2; MLH1 COCA2, FCC2, HNPCC, HNPCC2, MMRCS1, hMLH1 mutL homolog 1 DNA mismatch repair protein Mlh1|mutL homolog 1, colon cancer, nonpolyposis type 2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on MLH1, check out the MLH1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MLH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-MLH1 Antibody Picoband® (PB9724)
Hello CJ!
No publications found for PB9724
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-MLH1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-MLH1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-MLH1 Antibody Picoband®
Question
Is a blocking peptide available for product anti-MLH1 antibody (PB9724)?
Verified Customer
Verified customer
Asked: 2020-04-27
Answer
We do provide the blocking peptide for product anti-MLH1 antibody (PB9724). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-04-27
Question
Does anti-MLH1 antibody PB9724 work for WB with brain?
Verified Customer
Verified customer
Asked: 2020-04-06
Answer
According to the expression profile of brain, MLH1 is highly expressed in brain. So, it is likely that anti-MLH1 antibody PB9724 will work for WB with brain.
Boster Scientific Support
Answered: 2020-04-06
Question
I was wanting to use your anti-MLH1 antibody for WB for human brain on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human brain identification?
Verified Customer
Verified customer
Asked: 2020-03-30
Answer
You can see on the product datasheet, PB9724 anti-MLH1 antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-03-30
Question
My colleagues were happy with the WB result of your anti-MLH1 antibody. However we have observed positive staining in liver nucleus using this antibody. Is that expected? Could you tell me where is MLH1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-01-30
Answer
Based on literature, liver does express MLH1. Generally MLH1 expresses in nucleus. Regarding which tissues have MLH1 expression, here are a few articles citing expression in various tissues:
Brain, Corpus callosum, Kidney, and Substantia nigra, Pubmed ID: 14702039
Cervix carcinoma, Pubmed ID: 18669648
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Gall bladder, Pubmed ID: 8128251
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2020-01-30
Question
Is this PB9724 anti-MLH1 antibody reactive to the isotypes of MLH1?
Verified Customer
Verified customer
Asked: 2020-01-29
Answer
The immunogen of PB9724 anti-MLH1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human MLH1 (722-756aa KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC), different from the related mouse sequence by three amino acids, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-01-29
Question
My question regarding product PB9724, anti-MLH1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-10-21
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9724 anti-MLH1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-10-21
Question
Will PB9724 anti-MLH1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-10-01
Answer
You can see on the product datasheet, PB9724 anti-MLH1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-10-01
Question
I am looking for using your anti-MLH1 antibody for double-strand break repair via nonhomologous end joining studies. Has this antibody been tested with western blotting on human hela? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-09-17
Answer
We appreciate your inquiry. This PB9724 anti-MLH1 antibody is validated on human hela, hela whole cell lysates, a549 whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-09-17
Question
I see that the anti-MLH1 antibody PB9724 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-09-11
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-09-11
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-MLH1 antibody PB9724. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-09-03
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-09-03
Question
Do you have a BSA free version of anti-MLH1 antibody PB9724 available?
Verified Customer
Verified customer
Asked: 2019-08-22
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-MLH1 antibody PB9724 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-08-22
Question
See below the WB image, lot number and protocol we used for brain using anti-MLH1 antibody PB9724. Please let me know if you require anything else.
T. Wu
Verified customer
Asked: 2018-09-18
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-09-18
Question
We are currently using anti-MLH1 antibody PB9724 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on monkey tissues as well?
Verified Customer
Verified customer
Asked: 2018-06-29
Answer
The anti-MLH1 antibody (PB9724) has not been tested for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-06-29
Question
We have been able to see staining in human corpus callosum. Any tips? Is anti-MLH1 antibody supposed to stain corpus callosum positively?
Verified Customer
Verified customer
Asked: 2018-05-16
Answer
Based on literature corpus callosum does express MLH1. Based on Uniprot.org, MLH1 is expressed in testis, gall bladder, brain, corpus callosum, kidney substantia nigra, placenta, cervix carcinoma, leukemic t-cell, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have MLH1 expression, here are a few articles citing expression in various tissues:
Brain, Corpus callosum, Kidney, and Substantia nigra, Pubmed ID: 14702039
Cervix carcinoma, Pubmed ID: 18669648
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Gall bladder, Pubmed ID: 8128251
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2018-05-16
Question
Our lab want to know about to test anti-MLH1 antibody PB9724 on human brain for research purposes, then I may be interested in using anti-MLH1 antibody PB9724 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
S. Anderson
Verified customer
Asked: 2016-04-08
Answer
The products we sell, including anti-MLH1 antibody PB9724, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2016-04-08
