Anti-Lysozyme/LYZ Antibody Picoband®

Lysozyme antibody

Boster Bio Anti-Lysozyme/LYZ Antibody Picoband® catalog # PB9663. Tested in IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 2 publication(s).

Product Info Summary

SKU: PB9663
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Lysozyme/LYZ Antibody Picoband®

View all Lysozyme Antibodies

SKU/Catalog Number

PB9663

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Lysozyme/LYZ Antibody Picoband® catalog # PB9663. Tested in IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Lysozyme/LYZ Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9663)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9663 is reactive to LYZ in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

15-17 kDa

Calculated molecular weight

16537 MW

Background of Lysozyme

In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9663 is guaranteed for IF, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunofluorescence, 5μg/ml, Human, Mouse

Positive Control

WB: human THP-1 whole cell, human HL-60 whole cell, rat lung tissuerat PC-12 whole cellmouse lung tissuemouse RAW2647 whole cell
IHC: human intestinal cancer tissue
IF: human ileum tissue, human colon organoid tissue, mouse ileum tissue, mouse ileum organoid tissue

Validation Images & Assay Conditions

Gene/Protein Information For LYZ (Source: Uniprot.org, NCBI)

Gene Name

LYZ

Full Name

Lysozyme C

Weight

16537 MW

Superfamily

glycosyl hydrolase 22 family

Alternative Names

Lysozyme C;3.2.1.17;1,4-beta-N-acetylmuramidase C;LYZ;LZM; LYZ LYZF1, LZM lysozyme lysozyme C|1,4-beta-N-acetylmuramidase C|c-type lysozyme|lysozyme F1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on LYZ, check out the LYZ Infographic

LYZ infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LYZ: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9663 has been cited in 2 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Dynamic changes and mechanism of intestinal endotoxemia in partially hepatectomized rats

Dynamic changes and mechanism of intestinal endotoxemia in partially hepatectomized rats

Have you used Anti-Lysozyme/LYZ Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Lysozyme/LYZ Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Lysozyme/LYZ Antibody Picoband®

Question

We bought anti-Lysozyme/LYZ antibody for WB on milk in a previous project. I am using human, and We want to use the antibody for IF next. I would like examining milk as well as tear in our next experiment. Could you please give me some suggestion on which antibody would work the best for IF?

Verified Customer

Verified customer

Asked: 2020-04-07

Answer

I took a look at the website and datasheets of our anti-Lysozyme/LYZ antibody and I see that PB9663 has been validated on human in both WB and IF. Thus PB9663 should work for your application. Our Boster satisfaction guarantee will cover this product for IF in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IF detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-04-07

Question

I was wanting to use your anti-Lysozyme/LYZ antibody for IHC for rat nasal cavity mucosa on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat nasal cavity mucosa identification?

Verified Customer

Verified customer

Asked: 2020-02-04

Answer

You can see on the product datasheet, PB9663 anti-Lysozyme/LYZ antibody has been validated for IF, IHC, WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat nasal cavity mucosa in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-04

Question

Is this PB9663 anti-Lysozyme/LYZ antibody reactive to the isotypes of LYZ?

Verified Customer

Verified customer

Asked: 2019-09-19

Answer

The immunogen of PB9663 anti-Lysozyme/LYZ antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-09-19

Question

We are currently using anti-Lysozyme/LYZ antibody PB9663 for human tissue, and we are satisfied with the IF results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-09

Answer

The anti-Lysozyme/LYZ antibody (PB9663) has not been tested for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-09

Question

I see that the anti-Lysozyme/LYZ antibody PB9663 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-07-05

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-07-05

Question

Does anti-Lysozyme/LYZ antibody PB9663 work for IHC with nasal cavity mucosa?

Verified Customer

Verified customer

Asked: 2019-06-18

Answer

According to the expression profile of nasal cavity mucosa, LYZ is highly expressed in nasal cavity mucosa. So, it is likely that anti-Lysozyme/LYZ antibody PB9663 will work for IHC with nasal cavity mucosa.

Boster Scientific Support

Answered: 2019-06-18

Question

Can you help my question with product PB9663, anti-Lysozyme/LYZ antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Z. Evans

Verified customer

Asked: 2018-11-14

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9663 anti-Lysozyme/LYZ antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-11-14

Question

My team were happy with the WB result of your anti-Lysozyme/LYZ antibody. However we have observed positive staining in tear secreted. using this antibody. Is that expected? Could you tell me where is LYZ supposed to be expressed?

Verified Customer

Verified customer

Asked: 2018-08-30

Answer

According to literature, tear does express LYZ. Generally LYZ expresses in secreted. Regarding which tissues have LYZ expression, here are a few articles citing expression in various tissues:
Colon, Pubmed ID: 15489334
Milk, Pubmed ID: 5168859, 11946553
Tear, Pubmed ID: 25946035
Urine, Pubmed ID: 5284421, 11946554

Boster Scientific Support

Answered: 2018-08-30

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for nasal cavity mucosa using anti-Lysozyme/LYZ antibody PB9663. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-06-21

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-06-21

Question

Would PB9663 anti-Lysozyme/LYZ antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-06-18

Answer

It shows on the product datasheet, PB9663 anti-Lysozyme/LYZ antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-06-18

Question

Is a blocking peptide available for product anti-Lysozyme/LYZ antibody (PB9663)?

Verified Customer

Verified customer

Asked: 2017-12-07

Answer

We do provide the blocking peptide for product anti-Lysozyme/LYZ antibody (PB9663). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-12-07

Question

I was wanting to use to test anti-Lysozyme/LYZ antibody PB9663 on rat nasal cavity mucosa for research purposes, then I may be interested in using anti-Lysozyme/LYZ antibody PB9663 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

P. Johnson

Verified customer

Asked: 2017-09-19

Answer

The products we sell, including anti-Lysozyme/LYZ antibody PB9663, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-09-19

Question

We have observed staining in human tear. Are there any suggestions? Is anti-Lysozyme/LYZ antibody supposed to stain tear positively?

Verified Customer

Verified customer

Asked: 2017-08-15

Answer

From literature tear does express LYZ. From Uniprot.org, LYZ is expressed in nasal cavity mucosa, colon, urine, milk, tear, among other tissues. Regarding which tissues have LYZ expression, here are a few articles citing expression in various tissues:
Colon, Pubmed ID: 15489334
Milk, Pubmed ID: 5168859, 11946553
Tear, Pubmed ID: 25946035
Urine, Pubmed ID: 5284421, 11946554

Boster Scientific Support

Answered: 2017-08-15

Question

I have attached the WB image, lot number and protocol we used for nasal cavity mucosa using anti-Lysozyme/LYZ antibody PB9663. Please let me know if you require anything else.

B. Carter

Verified customer

Asked: 2017-07-13

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-07-13

Question

We want using your anti-Lysozyme/LYZ antibody for defense response to bacterium studies. Has this antibody been tested with western blotting on hepg2 whole cell lysate? We would like to see some validation images before ordering.

R. Huang

Verified customer

Asked: 2017-05-11

Answer

Thanks for your inquiry. This PB9663 anti-Lysozyme/LYZ antibody is tested on rat liver tissue, intestinal cancer tissue, tissue lysate, kidney tissue, hela whole cell lysate, sw620 whole cell lysate, 293t whole cell lysate, hepg2 whole cell lysate, human ileum tissue, ileum organoid tissue, colon organoid tissue, mouse ileum tissue. It is guaranteed to work for IF, IHC, WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-05-11

Question

Is there a BSA free version of anti-Lysozyme/LYZ antibody PB9663 available?

R. Li

Verified customer

Asked: 2017-02-03

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Lysozyme/LYZ antibody PB9663 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-02-03

Order DetailsPrice
PB9663

100μg

$370
PB9663-10ug

10μg sample (liquid)

$99
PB9663-Biotin

100 μg Biotin conjugated

$570
PB9663-Cy3

100 μg Cy3 conjugated

$570
PB9663-Dylight488

100 μg Dylight488 conjugated

$570
PB9663-Dylight550

100 μg Dylight550 conjugated

$570
PB9663-Dylight594

100 μg Dylight594 conjugated

$570
PB9663-FITC

100 μg FITC conjugated

$570
PB9663-HRP

100 μg HRP conjugated

$570
PB9663-APC

100 μg APC conjugated

$670
PB9663-PE

100 μg PE conjugated

$670
PB9663-iFluor647

100 μg iFluor647 conjugated

$670
PB9663-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9663
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.