Product Info Summary
SKU: | PB9663 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IF, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Lysozyme/LYZ Antibody Picoband®
SKU/Catalog Number
PB9663
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Lysozyme/LYZ Antibody Picoband® catalog # PB9663. Tested in IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Lysozyme/LYZ Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9663)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9663 is reactive to LYZ in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
15-17 kDa
Calculated molecular weight
16537 MW
Background of Lysozyme
In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9663 is guaranteed for IF, IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunofluorescence, 5μg/ml, Human, Mouse
Positive Control
WB: human THP-1 whole cell, human HL-60 whole cell, rat lung tissuerat PC-12 whole cellmouse lung tissuemouse RAW2647 whole cell
IHC: human intestinal cancer tissue
IF: human ileum tissue, human colon organoid tissue, mouse ileum tissue, mouse ileum organoid tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Lysozyme using anti-Lysozyme antibody (PB9663).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human THP-1 whole cell lysates,
Lane 2: human HL-60 whole cell lysates,
Lane 3: rat lung tissue lysates.
Lane 4: rat PC-12 whole cell lysates.
Lane 5: mouse lung tissue lysates.
Lane 6: mouse RAW264.7 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Lysozyme antigen affinity purified polyclonal antibody (Catalog # PB9663) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Lysozyme at approximately 15-17 kDa. The expected band size for Lysozyme is at 17 kDa.
Click image to see more details
Figure 2. IHC analysis of Lysozyme using anti-Lysozyme antibody (PB9663).
Lysozyme was detected in a paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Lysozyme Antibody (PB9663) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IF analysis of Lysozyme using anti-Lysozyme antibody (PB9663).
Lysozyme was detected in paraffin-embedded section of human ileum tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5μg/mL rabbit anti-Lysozyme Antibody (PB9663) overnight at 4°C. Cy3 Conjugated Goat Anti-Rabbit IgG (BA1032) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 4. IF analysis of Lysozyme using anti-Lysozyme antibody (PB9663).
Lysozyme was detected in paraffin-embedded section of human colon organoid tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5μg/mL rabbit anti-Lysozyme Antibody (PB9663) overnight at 4°C. Cy3 Conjugated Goat Anti-Rabbit IgG (BA1032) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 5. IF analysis of Lysozyme using anti-Lysozyme antibody (PB9663).
Lysozyme was detected in paraffin-embedded section of mouse ileum tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5μg/mL rabbit anti-Lysozyme Antibody (PB9663) overnight at 4°C. Cy3 Conjugated Goat Anti-Rabbit IgG (BA1032) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 6. IF analysis of Lysozyme using anti-Lysozyme antibody (PB9663).
Lysozyme was detected in paraffin-embedded section of mouse ileum organoid tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5μg/mL rabbit anti-Lysozyme Antibody (PB9663) overnight at 4°C. Cy3 Conjugated Goat Anti-Rabbit IgG (BA1032) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For LYZ (Source: Uniprot.org, NCBI)
Gene Name
LYZ
Full Name
Lysozyme C
Weight
16537 MW
Superfamily
glycosyl hydrolase 22 family
Alternative Names
Lysozyme C;3.2.1.17;1,4-beta-N-acetylmuramidase C;LYZ;LZM; LYZ LYZF1, LZM lysozyme lysozyme C|1,4-beta-N-acetylmuramidase C|c-type lysozyme|lysozyme F1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on LYZ, check out the LYZ Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for LYZ: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Lysozyme/LYZ Antibody Picoband® (PB9663)
Hello CJ!
PB9663 has been cited in 2 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Dynamic changes and mechanism of intestinal endotoxemia in partially hepatectomized rats
Dynamic changes and mechanism of intestinal endotoxemia in partially hepatectomized rats
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Lysozyme/LYZ Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Lysozyme/LYZ Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Lysozyme/LYZ Antibody Picoband®
Question
We bought anti-Lysozyme/LYZ antibody for WB on milk in a previous project. I am using human, and We want to use the antibody for IF next. I would like examining milk as well as tear in our next experiment. Could you please give me some suggestion on which antibody would work the best for IF?
Verified Customer
Verified customer
Asked: 2020-04-07
Answer
I took a look at the website and datasheets of our anti-Lysozyme/LYZ antibody and I see that PB9663 has been validated on human in both WB and IF. Thus PB9663 should work for your application. Our Boster satisfaction guarantee will cover this product for IF in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IF detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2020-04-07
Question
I was wanting to use your anti-Lysozyme/LYZ antibody for IHC for rat nasal cavity mucosa on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat nasal cavity mucosa identification?
Verified Customer
Verified customer
Asked: 2020-02-04
Answer
You can see on the product datasheet, PB9663 anti-Lysozyme/LYZ antibody has been validated for IF, IHC, WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat nasal cavity mucosa in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-02-04
Question
Is this PB9663 anti-Lysozyme/LYZ antibody reactive to the isotypes of LYZ?
Verified Customer
Verified customer
Asked: 2019-09-19
Answer
The immunogen of PB9663 anti-Lysozyme/LYZ antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-09-19
Question
We are currently using anti-Lysozyme/LYZ antibody PB9663 for human tissue, and we are satisfied with the IF results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2019-08-09
Answer
The anti-Lysozyme/LYZ antibody (PB9663) has not been tested for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-09
Question
I see that the anti-Lysozyme/LYZ antibody PB9663 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-07-05
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-07-05
Question
Does anti-Lysozyme/LYZ antibody PB9663 work for IHC with nasal cavity mucosa?
Verified Customer
Verified customer
Asked: 2019-06-18
Answer
According to the expression profile of nasal cavity mucosa, LYZ is highly expressed in nasal cavity mucosa. So, it is likely that anti-Lysozyme/LYZ antibody PB9663 will work for IHC with nasal cavity mucosa.
Boster Scientific Support
Answered: 2019-06-18
Question
Can you help my question with product PB9663, anti-Lysozyme/LYZ antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Z. Evans
Verified customer
Asked: 2018-11-14
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9663 anti-Lysozyme/LYZ antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-11-14
Question
My team were happy with the WB result of your anti-Lysozyme/LYZ antibody. However we have observed positive staining in tear secreted. using this antibody. Is that expected? Could you tell me where is LYZ supposed to be expressed?
Verified Customer
Verified customer
Asked: 2018-08-30
Answer
According to literature, tear does express LYZ. Generally LYZ expresses in secreted. Regarding which tissues have LYZ expression, here are a few articles citing expression in various tissues:
Colon, Pubmed ID: 15489334
Milk, Pubmed ID: 5168859, 11946553
Tear, Pubmed ID: 25946035
Urine, Pubmed ID: 5284421, 11946554
Boster Scientific Support
Answered: 2018-08-30
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for nasal cavity mucosa using anti-Lysozyme/LYZ antibody PB9663. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-06-21
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-06-21
Question
Would PB9663 anti-Lysozyme/LYZ antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-06-18
Answer
It shows on the product datasheet, PB9663 anti-Lysozyme/LYZ antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-06-18
Question
Is a blocking peptide available for product anti-Lysozyme/LYZ antibody (PB9663)?
Verified Customer
Verified customer
Asked: 2017-12-07
Answer
We do provide the blocking peptide for product anti-Lysozyme/LYZ antibody (PB9663). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-12-07
Question
I was wanting to use to test anti-Lysozyme/LYZ antibody PB9663 on rat nasal cavity mucosa for research purposes, then I may be interested in using anti-Lysozyme/LYZ antibody PB9663 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
P. Johnson
Verified customer
Asked: 2017-09-19
Answer
The products we sell, including anti-Lysozyme/LYZ antibody PB9663, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-09-19
Question
We have observed staining in human tear. Are there any suggestions? Is anti-Lysozyme/LYZ antibody supposed to stain tear positively?
Verified Customer
Verified customer
Asked: 2017-08-15
Answer
From literature tear does express LYZ. From Uniprot.org, LYZ is expressed in nasal cavity mucosa, colon, urine, milk, tear, among other tissues. Regarding which tissues have LYZ expression, here are a few articles citing expression in various tissues:
Colon, Pubmed ID: 15489334
Milk, Pubmed ID: 5168859, 11946553
Tear, Pubmed ID: 25946035
Urine, Pubmed ID: 5284421, 11946554
Boster Scientific Support
Answered: 2017-08-15
Question
I have attached the WB image, lot number and protocol we used for nasal cavity mucosa using anti-Lysozyme/LYZ antibody PB9663. Please let me know if you require anything else.
B. Carter
Verified customer
Asked: 2017-07-13
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-07-13
Question
We want using your anti-Lysozyme/LYZ antibody for defense response to bacterium studies. Has this antibody been tested with western blotting on hepg2 whole cell lysate? We would like to see some validation images before ordering.
R. Huang
Verified customer
Asked: 2017-05-11
Answer
Thanks for your inquiry. This PB9663 anti-Lysozyme/LYZ antibody is tested on rat liver tissue, intestinal cancer tissue, tissue lysate, kidney tissue, hela whole cell lysate, sw620 whole cell lysate, 293t whole cell lysate, hepg2 whole cell lysate, human ileum tissue, ileum organoid tissue, colon organoid tissue, mouse ileum tissue. It is guaranteed to work for IF, IHC, WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-05-11
Question
Is there a BSA free version of anti-Lysozyme/LYZ antibody PB9663 available?
R. Li
Verified customer
Asked: 2017-02-03
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Lysozyme/LYZ antibody PB9663 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-02-03