Product Info Summary
SKU: | PB9716 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-LIMK1 Antibody Picoband™
SKU/Catalog Number
PB9716
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-LIMK1 Antibody Picoband™ catalog # PB9716. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-LIMK1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9716)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9716 is reactive to LIMK1 in Human, Mouse, Rat
Applications
PB9716 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
72 kDa
Calculated molecular weight
72585 MW
Background of LIMK1
LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Validation Images & Assay Conditions
![pb9716 1 WB anti limk1 lim kinase 1 picoband antibody pb9716 1 WB anti limk1 lim kinase 1 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9716-1-WB-anti-limk1-lim-kinase-1-picoband-antibody.jpg)
Click image to see more details
Figure 1. Western blot analysis of LIMK1 using anti-LIMK1 antibody (PB9716).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Brain Tissue Lysate at 50ug,
Lane 2: Mouse Gaster Tissue Lysate at 50ug,
Lane 3: HELA Whole Cell Lysate at 40ug,
Lane 4: U87 Whole Cell Lysate at 40ug,
Lane 5: SKOV Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-LIMK1 antigen affinity purified polyclonal antibody (Catalog # PB9716) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for LIMK1 at approximately 72 kDa. The expected band size for LIMK1 is at 72 kDa.
Protein Target Info & Infographic
Gene/Protein Information For LIMK1 (Source: Uniprot.org, NCBI)
Gene Name
LIMK1
Full Name
LIM domain kinase 1
Weight
72585 MW
Superfamily
protein kinase superfamily
Alternative Names
EC 2.7.11.1; LIM domain kinase 1; LIM motif-containing protein kinase; LIMKLIMK-1 LIMK1 LIMK, LIMK-1 LIM domain kinase 1 LIM domain kinase 1|LIM motif-containing protein kinase
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on LIMK1, check out the LIMK1 Infographic
![LIMK1 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for LIMK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-LIMK1 Antibody Picoband™ (PB9716)
Hello CJ!
PB9716 has been cited in 2 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Han F,Xu H,Shen JX,Pan C,Yu ZH,Chen JJ,Zhu XL,Cai YF,Lu YP.RhoA/Rock2/Limk1/cofilin1 pathway is involved in attenuation of neuronal dendritic spine loss by paeonol in the frontal cortex of D-galactose and aluminum‑induced Alzheimer‘s disease‑like ra
Species: Rat
PB9716 usage in article: APP:WB, SAMPLE:BRAIN TISSUE, DILUTION:1:300
Zhang W, Gan N, Zhou J. J Int Med Res. 2012;40(3):1067-73. Immunohistochemical Investigation Of The Correlation Between Lim Kinase 1 Expression And Development And Progression Of Human Ovarian Carcinoma.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-LIMK1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-LIMK1 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-LIMK1 Antibody Picoband™
Question
Is there a BSA free version of anti-LIMK1 antibody PB9716 available?
Verified Customer
Verified customer
Asked: 2020-02-28
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-LIMK1 antibody PB9716 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-02-28
Question
We are currently using anti-LIMK1 antibody PB9716 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-30
Answer
The anti-LIMK1 antibody (PB9716) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-30
Question
Does PB9716 anti-LIMK1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-07-11
Answer
You can see on the product datasheet, PB9716 anti-LIMK1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-07-11
Question
I have attached the WB image, lot number and protocol we used for hippocampus placenta using anti-LIMK1 antibody PB9716. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-05-15
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-05-15
Question
Is this PB9716 anti-LIMK1 antibody reactive to the isotypes of LIMK1?
Verified Customer
Verified customer
Asked: 2019-01-22
Answer
The immunogen of PB9716 anti-LIMK1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-01-22