Click image to see more details
Product Info Summary
| SKU: | M00714-Dyl550 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Mouse |
| Application: | Flow Cytometry |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10)
SKU/Catalog Number
M00714-Dyl550
Size
100 μg/vial
Form
Liquid
Description
Boster Bio Anti-Human Emerin DyLight® 550 conjugated EMD Antibody (monoclonal, 5A10) catalog # M00714-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Storage & Handling
At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
Cite This Product
Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00714-Dyl550)
Host
Mouse
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Monoclonal
Clone Number
5A10
Isotype
Mouse IgG1
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin, different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
M00714-Dyl550 is reactive to EMD in Human
Reconstitution
Observed Molecular Weight
39 kDa
Calculated molecular weight
28.994kDa
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
M00714-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For EMD (Source: Uniprot.org, NCBI)
Gene Name
EMD
Full Name
Emerin
Weight
28.994kDa
Alternative Names
Emerin; EMD; EDMD; STA EMD EDMD, LEMD5, STA emerin emerin|LEM domain containing 5
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on EMD, check out the EMD Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for EMD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10) (M00714-Dyl550)
Hello CJ!
No publications found for M00714-Dyl550
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10)?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10)
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-Human Emerin DyLight® 550 conjugated EMD Antibody(monoclonal, 5A10)
Question
We are currently using anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 for human tissue, and we are content with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on horse tissues as well?
P. Williams
Verified customer
Asked: 2020-03-18
Answer
The anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) (M00714-Dyl550) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-03-18
Question
Is there a BSA free version of anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 available?
Verified Customer
Verified customer
Asked: 2020-02-28
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-02-28
Question
Is a blocking peptide available for product anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) (M00714-Dyl550)?
J. Brown
Verified customer
Asked: 2020-01-14
Answer
We do provide the blocking peptide for product anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) (M00714-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-01-14
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-01-08
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-08
Question
Would anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 work on monkey Flow Cytometry with cervix carcinoma erythroleukemia?
Verified Customer
Verified customer
Asked: 2019-09-05
Answer
Our lab technicians have not tested anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 on monkey. You can run a BLAST between monkey and the immunogen sequence of anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated monkey samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in monkey cervix carcinoma erythroleukemia in Flow Cytometry, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-09-05
Question
Is this M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) reactive to the isotypes of EMD?
Verified Customer
Verified customer
Asked: 2019-08-28
Answer
The immunogen of M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) is A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-08-28
Question
I see that the anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-07-10
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-07-10
Question
My colleagues were content with the WB result of your anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10). However we have observed positive staining in platelet nucleus inner membrane using this antibody. Is that expected? Could you tell me where is EMD supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-06-04
Answer
According to literature, platelet does express EMD. Generally EMD expresses in nucleus inner membrane. Regarding which tissues have EMD expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 18691976, 20068231
Cervix carcinoma, and Embryonic kidney, Pubmed ID: 9673989
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 15489334
Platelet, Pubmed ID: 12665801
Teratocarcinoma, Pubmed ID: 7894480
Boster Scientific Support
Answered: 2019-06-04
Question
Please see the WB image, lot number and protocol we used for placenta using anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-05-28
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-05-28
Question
Does M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-04-08
Answer
As indicated on the product datasheet, M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) as been tested on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-04-08
Question
Does anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 work for Flow Cytometry with placenta?
Verified Customer
Verified customer
Asked: 2019-03-08
Answer
According to the expression profile of placenta, EMD is highly expressed in placenta. So, it is likely that anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 will work for Flow Cytometry with placenta.
Boster Scientific Support
Answered: 2019-03-08
Question
We have seen staining in human leukemic t-cell. Are there any suggestions? Is anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) supposed to stain leukemic t-cell positively?
Verified Customer
Verified customer
Asked: 2018-02-15
Answer
From literature leukemic t-cell does express EMD. From Uniprot.org, EMD is expressed in esophagogastric junction muscularis propria, teratocarcinoma, placenta, platelet, cervix carcinoma embryonic kidney, leukemic t-cell, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have EMD expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 18691976, 20068231
Cervix carcinoma, and Embryonic kidney, Pubmed ID: 9673989
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 15489334
Platelet, Pubmed ID: 12665801
Teratocarcinoma, Pubmed ID: 7894480
Boster Scientific Support
Answered: 2018-02-15
Question
I was wanting to use your anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) for Flow Cytometry for human placenta on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human placenta identification?
K. Wu
Verified customer
Asked: 2017-07-20
Answer
You can see on the product datasheet, M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) has been validated for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human placenta in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-07-20
Question
Can you help my question with product M00714-Dyl550, anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10). I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2017-06-30
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free M00714-Dyl550 anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10), we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-06-30
Question
Our lab want to know about to test anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 on human placenta for research purposes, then I may be interested in using anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
T. Rodriguez
Verified customer
Asked: 2015-04-01
Answer
The products we sell, including anti-Human Emerin DyLight® 550 conjugated antibody(monoclonal, 5A10) M00714-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-04-01
