Anti-Emerin/EMD Antibody Picoband®

Emerin antibody

Boster Bio Anti-Emerin/EMD Antibody Picoband® catalog # A00714. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A00714
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Product Name

Anti-Emerin/EMD Antibody Picoband®

View all Emerin Antibodies

SKU/Catalog Number

A00714

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Emerin/EMD Antibody Picoband® catalog # A00714. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Emerin/EMD Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00714)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin, different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A00714 is reactive to EMD in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

34 kDa

Calculated molecular weight

28994 MW

Background of Emerin

Emerin is a serine-rich nuclear membrane protein that in humans is encoded by the EMD gene. And this gene is mapped to Xq28. Emerin is a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Emery–Dreifuss muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the EMD (also known clinically as STA) gene. Emerin appears to be involved in mechanotransduction, as emerin-deficient mouse fibroblasts failed to transduce normal mechanosensitive gene expression responses to strain stimuli. In cardiac muscle, emerin is also found complexed to beta-catenin at adherens junctions of intercalated discs, and cardiomyocytes from hearts lacking emerin showed beta-catenin redistribution as well as perturbed intercalated disc architecture and myocyte shape. This interaction appears to be regulated by glycogen synthase kinase 3 beta.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00714 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunofluorescence, 2μg/ml, Human
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: human Hela whole cell, human 293T whole cell, rat NRK whole cell, rat C6 whole cell, mouse NIH/3T3 whole cell, mouse Neuro-2a whole cell
IHC: human endometrial carcinoma tissue, human colon cancer tissue, human oesophagus squama cancer tissue
ICC/IF: U20S cell
IF: human oesophagus squama cancer tissue, human oesophagus squama cancer tissue, human lung cancer tissue
FCM: U20S cell

Validation Images & Assay Conditions

Gene/Protein Information For EMD (Source: Uniprot.org, NCBI)

Gene Name

EMD

Full Name

Emerin

Weight

28994 MW

Alternative Names

Emerin;EMD;EDMD, STA; EMD EDMD, LEMD5, STA emerin emerin|LEM domain containing 5

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on EMD, check out the EMD Infographic

EMD infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EMD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00714

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Emerin/EMD Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Emerin/EMD Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Emerin/EMD Antibody Picoband®

Question

My team were happy with the WB result of your anti-Emerin/EMD antibody. However we have seen positive staining in leukemic t-cell nucleus inner membrane using this antibody. Is that expected? Could you tell me where is EMD supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-04-14

Answer

From what I have seen in literature, leukemic t-cell does express EMD. Generally EMD expresses in nucleus inner membrane. Regarding which tissues have EMD expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 18691976, 20068231
Cervix carcinoma, and Embryonic kidney, Pubmed ID: 9673989
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 15489334
Platelet, Pubmed ID: 12665801
Teratocarcinoma, Pubmed ID: 7894480

Boster Scientific Support

Answered: 2020-04-14

Question

I am looking for using your anti-Emerin/EMD antibody for muscle organ development studies. Has this antibody been tested with western blotting on mouse cardiac muscle tissue lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-03-12

Answer

Thank you for your inquiry. This A00714 anti-Emerin/EMD antibody is tested on rat skeletal muscle tissue, mouse cardiac muscle tissue lysates, hela whole cell lysates, u20s cells. It is guaranteed to work for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-03-12

Question

We have been able to see staining in rat esophagogastric junction muscularis propria. Do you have any suggestions? Is anti-Emerin/EMD antibody supposed to stain esophagogastric junction muscularis propria positively?

Verified Customer

Verified customer

Asked: 2020-01-28

Answer

From literature esophagogastric junction muscularis propria does express EMD. From Uniprot.org, EMD is expressed in esophagogastric junction muscularis propria, teratocarcinoma, placenta, platelet, cervix carcinoma embryonic kidney, leukemic t-cell, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have EMD expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 18691976, 20068231
Cervix carcinoma, and Embryonic kidney, Pubmed ID: 9673989
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 15489334
Platelet, Pubmed ID: 12665801
Teratocarcinoma, Pubmed ID: 7894480

Boster Scientific Support

Answered: 2020-01-28

Question

I am interested in to test anti-Emerin/EMD antibody A00714 on rat leukemic t-cell for research purposes, then I may be interested in using anti-Emerin/EMD antibody A00714 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-12-18

Answer

The products we sell, including anti-Emerin/EMD antibody A00714, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-12-18

Question

I was wanting to use your anti-Emerin/EMD antibody for IHC-P for rat leukemic t-cell on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat leukemic t-cell identification?

Verified Customer

Verified customer

Asked: 2019-09-17

Answer

You can see on the product datasheet, A00714 anti-Emerin/EMD antibody has been tested for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat leukemic t-cell in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-17

Question

Here is the WB image, lot number and protocol we used for leukemic t-cell using anti-Emerin/EMD antibody A00714. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-08-14

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-14

Question

My question regarding product A00714, anti-Emerin/EMD antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-07-12

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00714 anti-Emerin/EMD antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-07-12

Question

I see that the anti-Emerin/EMD antibody A00714 works with IHC-P, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-03-06

Answer

You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-03-06

Question

We are currently using anti-Emerin/EMD antibody A00714 for mouse tissue, and we are satisfied with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2018-07-11

Answer

The anti-Emerin/EMD antibody (A00714) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-07-11

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukemic t-cell using anti-Emerin/EMD antibody A00714. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-05-30

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-05-30

Question

We bought anti-Emerin/EMD antibody for ICC on cervix carcinoma erythroleukemia last year. I am using mouse, and We intend to use the antibody for IHC-F next. We need examining cervix carcinoma erythroleukemia as well as platelet in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC-F?

Verified Customer

Verified customer

Asked: 2018-04-11

Answer

I viewed the website and datasheets of our anti-Emerin/EMD antibody and I see that A00714 has been validated on mouse in both ICC and IHC-F. Thus A00714 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC-F in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC-F detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2018-04-11

Question

Is a blocking peptide available for product anti-Emerin/EMD antibody (A00714)?

Verified Customer

Verified customer

Asked: 2017-10-27

Answer

We do provide the blocking peptide for product anti-Emerin/EMD antibody (A00714). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-10-27

Question

Will A00714 anti-Emerin/EMD antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2017-08-07

Answer

You can see on the product datasheet, A00714 anti-Emerin/EMD antibody as been validated on IHC-P. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-08-07

Question

Is this A00714 anti-Emerin/EMD antibody reactive to the isotypes of EMD?

Verified Customer

Verified customer

Asked: 2017-06-05

Answer

The immunogen of A00714 anti-Emerin/EMD antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino ac. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-06-05

Question

Do you have a BSA free version of anti-Emerin/EMD antibody A00714 available?

M. Bhatt

Verified customer

Asked: 2014-01-01

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Emerin/EMD antibody A00714 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2014-01-01

Question

Does anti-Emerin/EMD antibody A00714 work for IHC-P with leukemic t-cell?

S. Johnson

Verified customer

Asked: 2013-09-23

Answer

According to the expression profile of leukemic t-cell, EMD is highly expressed in leukemic t-cell. So, it is likely that anti-Emerin/EMD antibody A00714 will work for IHC-P with leukemic t-cell.

Boster Scientific Support

Answered: 2013-09-23

Order DetailsPrice
A00714

100μg

$370
A00714-10ug

10μg sample (liquid)

$99
A00714-Biotin

100 μg Biotin conjugated

$570
A00714-Cy3

100 μg Cy3 conjugated

$570
A00714-Dylight488

100 μg Dylight488 conjugated

$570
A00714-Dylight550

100 μg Dylight550 conjugated

$570
A00714-Dylight594

100 μg Dylight594 conjugated

$570
A00714-FITC

100 μg FITC conjugated

$570
A00714-HRP

100 μg HRP conjugated

$570
A00714-APC

100 μg APC conjugated

$670
A00714-PE

100 μg PE conjugated

$670
A00714-iFluor647

100 μg iFluor647 conjugated

$670
A00714-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00714
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.