Data

Array ( [0] => store_id [1] => entity_id [2] => attribute_set_id [3] => type_id [4] => sku [5] => has_options [6] => required_options [7] => created_at [8] => updated_at [9] => mst_search_weight [10] => status [11] => name [12] => cj_search_index [13] => publication_count [14] => qty_in_warehouses [15] => is_recurring [16] => visibility [17] => tax_class_id [18] => featured [19] => featured_image [20] => fb_product [21] => custom_product_page [22] => free_shipping [23] => template [24] => host [25] => quantity_and_stock_status [26] => googleshopping_exclude [27] => yoast_keyword_score [28] => yoast_content_score [29] => badge [30] => price [31] => weight [32] => meta_title [33] => meta_description [34] => image [35] => small_image [36] => thumbnail [37] => url_key [38] => url_path [39] => options_container [40] => image_label [41] => small_image_label [42] => thumbnail_label [43] => msrp_display_actual_price_type [44] => gift_message_available [45] => size [46] => protein_name [47] => gene_full_name [48] => uniprot_id [49] => reconstitution [50] => sensitivity [51] => applications [52] => reactivity [53] => form [54] => concentration [55] => cross_reactivity [56] => recommended_detection_systems [57] => predicted_reactivity [58] => source_company [59] => isotype [60] => molecular_weight [61] => sample_size_available [62] => related_product_skus [63] => product_category [64] => research_category [65] => clonality [66] => swatch_image [67] => rating_value [68] => review_count [69] => phospho_site [70] => mp_exclude_sitemap [71] => yoast_focus_keyword [72] => yoast_facebook_image [73] => yoast_twitter_image [74] => cj_related_products [75] => description [76] => short_description [77] => meta_keyword [78] => contents [79] => background [80] => gene_name [81] => synonyms [82] => application_details [83] => subcellular_localization [84] => sequence_similarities [85] => tissue_specificity [86] => protein_function [87] => application_notes [88] => competitor_equivalent_skus [89] => immunogen [90] => purification [91] => storage [92] => custom_attribute_1 [93] => custom_attribute_2 [94] => custom_attribute_3 [95] => options [96] => media_gallery [97] => extension_attributes [98] => tier_price [99] => tier_price_changed [100] => category_ids [101] => is_salable [102] => website_ids [103] => request_path [104] => rating_summary [105] => _cache_instance_store_filter [106] => media_gallery_images )
Key=store_id
Key=entity_id, value=3250
Key=attribute_set_id, value=4
Key=type_id, value=simple
Key=sku, value=PB9635
Key=has_options, value=1
Key=required_options, value=1
Key=created_at, value=2015-09-24 18:43:16
Key=updated_at, value=2024-09-26 00:46:47
Key=mst_search_weight, value=0
Key=status, value=Enabled
Key=name, value=Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®
Key=cj_search_index
Key=publication_count, value=2
Key=qty_in_warehouses
Key=is_recurring, value=No
Key=visibility, value=Catalog, Search
Key=tax_class_id, value=Taxable Goods
Key=featured, value=No
Key=featured_image, value=Yes
Key=fb_product, value=
Key=custom_product_page, value=No
Key=free_shipping, value=No
Key=template, value=antibodies
Key=host, value=Rabbit
Key=quantity_and_stock_status
Key=googleshopping_exclude, value=No
Key=yoast_keyword_score, value=-1336
Key=yoast_content_score, value=30
Key=badge, value=free-antibody-validation
Key=price, value=370.0000
Key=weight, value=1.0000
Key=meta_title, value=Hsp90 alpha/HSP90AA1 Antibody PB9635
Key=meta_description, value=Boster Bio Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband® catalog # PB9635. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.
Key=image, value=/p/b/pb9635-3.jpg
Key=small_image, value=/p/b/pb9635-3.jpg
Key=thumbnail, value=/p/b/pb9635-3.jpg
Key=url_key, value=anti-hsp90-alpha-picoband-trade-antibody-pb9635-boster
Key=url_path, value=anti-hsp90-alpha-picoband-trade-antibody-pb9635-boster
Key=options_container, value=Product Info Column
Key=image_label, value=Anti- Hsp90 alpha Picoband antibody, PB9635, IHC(P)
IHC(P): Rat Testis Tissue
Key=small_image_label, value=Anti- Hsp90 alpha Picoband antibody, PB9635, IHC(P)
IHC(P): Rat Testis Tissue
Key=thumbnail_label, value=Anti- Hsp90 alpha Picoband antibody, PB9635, IHC(P)
IHC(P): Rat Testis Tissue
Key=msrp_display_actual_price_type, value=
Key=gift_message_available, value=No
Key=size, value=100 μg/vial
Key=protein_name, value=Heat shock protein HSP 90-alpha
Key=gene_full_name, value=Heat shock protein HSP 90-alpha
Key=uniprot_id, value=P07900
Key=reconstitution, value=Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Key=sensitivity
Key=applications, value=Flow Cytometry, IF, IHC, ICC, WB
Key=reactivity, value=Human, Monkey, Mouse, Rat
Key=form, value=Lyophilized
Key=concentration, value=Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Key=cross_reactivity, value=No cross-reactivity with other proteins
Key=recommended_detection_systems, value=Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.
Key=predicted_reactivity
Key=source_company, value=Boster PB9635
Key=isotype, value=Rabbit IgG
Key=molecular_weight, value=84660 MW
Key=sample_size_available, value=30ug for $99, contact us for details
Key=related_product_skus, value=B0001-5,AR1156,AR0146
Key=product_category, value=Primary Antibodies
Key=research_category, value=Cancer, Chaperones, Heat Shock Proteins, Protein Trafficking, Signal Transduction, Tumor Biomarkers
Key=clonality, value=Polyclonal
Key=swatch_image, value=/e/k/ek0697.png
Key=rating_value, value=100
Key=review_count, value=6
Key=phospho_site
Key=mp_exclude_sitemap, value=Yes
Key=yoast_focus_keyword, value=CD68 antibody
Key=yoast_facebook_image, value=/p/b/pb9568-ahsg-primary-antibodies-wb-testing-1.jpg
Key=yoast_twitter_image, value=/p/b/pb9568-ahsg-primary-antibodies-wb-testing-1.jpg
Key=cj_related_products, value=Dna Modification:M07702^Protein Acetylation:A05636-1|PB9713|PB9160^Scrapie:M01103-1|M01103-2
Key=description, value=Boster Bio Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband® catalog # PB9635. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Key=short_description, value=Boster Bio Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband® catalog # PB9635. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Key=meta_keyword, value=Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®
Key=contents, value=Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Key=background, value=Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.
Key=gene_name, value=HSP90AA1
Key=synonyms, value=Heat shock protein HSP 90-alpha;Heat shock 86 kDa;HSP 86;HSP86;Lipopolysaccharide-associated protein 2;LAP-2;LPS-associated protein 2;Renal carcinoma antigen NY-REN-38;HSP90AA1;HSP90A, HSPC1, HSPCA;
Key=application_details, value=Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Key=subcellular_localization, value= Cytoplasm. Melanosome. Cell membrane. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Key=sequence_similarities, value=Contains 1 HMG box DNA-binding domain.
Key=tissue_specificity, value= Expressed in heart, skeletal muscle, eye and brain, and at much lower levels in some other tissues. .
Key=protein_function, value= Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes. .
Key=application_notes, value=Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
Key=competitor_equivalent_skus, value=sc 244563
Key=immunogen, value=A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha, identical to the related mouse and rat sequences.
Key=purification, value=Immunogen affinity purified.
Key=storage, value=Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Key=custom_attribute_1, value=90 kDa
Key=custom_attribute_2, value=WB: human Hela whole cell, human HEK293 whole cell, monkey COS-7 whole cell, human HepG2 whole cell, human A549 whole cell, rat PC-12 whole cell, rat RH35 whole cell, mouse HEPA1-6 whole cell
IHC: mouse testis tissue, rat testis tissue, human testis tissue
ICC/IF: U20S cell
FCM: SiHa cell
Key=custom_attribute_3, value=PB0681
Key=options
Key=media_gallery
Key=extension_attributes
Key=tier_price
Key=tier_price_changed
Key=category_ids
Key=is_salable
Key=website_ids
Key=request_path
Key=rating_summary
Key=_cache_instance_store_filter
Key=media_gallery_images

Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®

HSP90AA1 antibody

Boster Bio Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband® catalog # PB9635. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 6 publication(s).

Product Info Summary

SKU: PB9635
Size: 100 μg/vial
Reactive Species: Human, Monkey, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Product Name

Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®

View all HSP90AA1 Antibodies

SKU/Catalog Number

PB9635

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband® catalog # PB9635. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9635)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9635 is reactive to HSP90AA1 in Human, Monkey, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

90 kDa

Calculated molecular weight

84660 MW

Background of HSP90AA1

Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9635 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: human Hela whole cell, human HEK293 whole cell, monkey COS-7 whole cell, human HepG2 whole cell, human A549 whole cell, rat PC-12 whole cell, rat RH35 whole cell, mouse HEPA1-6 whole cell
IHC: mouse testis tissue, rat testis tissue, human testis tissue
ICC/IF: U20S cell
FCM: SiHa cell

Validation Images & Assay Conditions

Gene/Protein Information For HSP90AA1 (Source: Uniprot.org, NCBI)

Gene Name

HSP90AA1

Full Name

Heat shock protein HSP 90-alpha

Weight

84660 MW

Superfamily

heat shock protein 90 family

Alternative Names

Heat shock protein HSP 90-alpha;Heat shock 86 kDa;HSP 86;HSP86;Lipopolysaccharide-associated protein 2;LAP-2;LPS-associated protein 2;Renal carcinoma antigen NY-REN-38;HSP90AA1;HSP90A, HSPC1, HSPCA; HSP90AA1 EL52, HEL-S-65p, HSP86, HSP89A, HSP90A, HSP90N, HSPC1, HSPCA, HSPCAL1, HSPCAL4, HSPN, Hsp103, Hsp89, Hsp90, LAP-2, LAP2 heat shock protein 90 alpha family class A member 1 heat shock protein HSP 90-alpha|HSP 86|LPS-associated protein 2|epididymis luminal secretory protein 52|epididymis secretory sperm binding protein Li 65p|heat shock 86 kDa|heat shock 90kD protein 1, alpha|heat shock 90kD protein 1, alpha-like 4|heat shock 90kD protein, alpha-like 4|heat shock 90kDa protein 1, alpha|heat shock protein 90kDa alpha (cytosolic), class A member 1|heat shock protein 90kDa alpha family class A member 1|lipopolysaccharide-associated protein 2|renal carcinoma NY-REN-38

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on HSP90AA1, check out the HSP90AA1 Infographic

HSP90AA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HSP90AA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9635 has been cited in 6 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Evaluation by different mechanisms of the protective effects of vitamin B12 on methotrexate nephrotoxicity

Thymoquinone attenuates doxorubicin‐cardiotoxicity in rats

Biaoxue Rong,Youwen Zhang,Junye Wang et al.Increased STIP1 and Hsp90 Correlate with Progression and Prognosis of Lung Adenocarcinoma,23 February 2021,PREPRINT (Version 1) available at Research Square [https://doi.org/10.21203/rs.3.rs-226260/v1]
Species: Human
PB9635 usage in article: APP:IHC, SAMPLE:LAC TISSUE, DILUTION:1:300

Youwen Zhang,Junye Wang,Shucheng Ye et al.Co-overexpression of STIP1 and Hsp90 correlates with progression and prognosis of lung adenocarcinoma,29 January 2020,PREPRINT (Version 2) available at Research Square [https://doi.org/10.21203/rs.2.13680/v2]
Species: Human
PB9635 usage in article: APP:IHC, SAMPLE:LAC TISSUE, DILUTION:1:300

The Effect of 5?-Adenylic Acid on Hepatic Proteome of Mice Radiated by 60Co ?-ray

Jiang Q, Wang Y, Li T, Shi K, Li Z, Ma Y, Li F, Luo H, Yang Y, Xu C. Mol Biol Cell. 2011 Apr 15;22(8):1167-80. Doi: 10.1091/Mbc.E10-10-0860. Epub 2011 Feb 23. Heat Shock Protein 90-Mediated Inactivation Of Nuclear Factor-??b Switches Autophagy To ...

Have you used Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-Hsp90 alpha/HSP90AA1 antibody PB9635. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-03-17

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-03-17

Question

Does PB9635 anti-Hsp90 alpha/HSP90AA1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-01-10

Answer

It shows on the product datasheet, PB9635 anti-Hsp90 alpha/HSP90AA1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-01-10

Question

We have been able to see staining in human lymphoblast. Are there any suggestions? Is anti-Hsp90 alpha/HSP90AA1 antibody supposed to stain lymphoblast positively?

Verified Customer

Verified customer

Asked: 2019-12-24

Answer

From literature lymphoblast does express HSP90AA1. From Uniprot.org, HSP90AA1 is expressed in middle temporal gyrus, peripheral blood lymphocyte, placenta, placenta teratocarcinoma, brain, cajal-retzius cell fetal brain cortex, heart, renal cell carcinoma, lymphoblast, cervix carcinoma, pituitary, t-cell, platelet, liver, leukemic t-cell, melanoma, cervix carcinoma erythroleukemia, among other tissues. Regarding which tissues have HSP90AA1 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Heart, Pubmed ID: 2492519, 10409742
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 18318008, 24275569
Lymphoblast, Pubmed ID: 14654843
Melanoma, Pubmed ID: 17081065
Peripheral blood lymphocyte, Pubmed ID: 2780322
Pituitary, Pubmed ID: 16807684
Placenta, Pubmed ID: 2527334, 15489334
Placenta, and Teratocarcinoma, Pubmed ID: 14702039
Platelet, Pubmed ID: 18088087
Renal cell carcinoma, Pubmed ID: 10508479, 11274138
T-cell, Pubmed ID: 19367720

Boster Scientific Support

Answered: 2019-12-24

Question

I was wanting to use your anti-Hsp90 alpha/HSP90AA1 antibody for WB for mouse brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse brain identification?

Verified Customer

Verified customer

Asked: 2019-12-17

Answer

You can see on the product datasheet, PB9635 anti-Hsp90 alpha/HSP90AA1 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-12-17

Question

My question regarding product PB9635, anti-Hsp90 alpha/HSP90AA1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-11-28

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9635 anti-Hsp90 alpha/HSP90AA1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-11-28

Question

I see that the anti-Hsp90 alpha/HSP90AA1 antibody PB9635 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-11-15

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-11-15

Question

We bought anti-Hsp90 alpha/HSP90AA1 antibody for WB on middle temporal gyrus last year. I am using human, and We intend to use the antibody for IHC next. I was wanting to use examining middle temporal gyrus as well as heart in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?

Verified Customer

Verified customer

Asked: 2019-11-11

Answer

I took a look at the website and datasheets of our anti-Hsp90 alpha/HSP90AA1 antibody and I see that PB9635 has been validated on human in both WB and IHC. Thus PB9635 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-11-11

Question

My boss were satisfied with the WB result of your anti-Hsp90 alpha/HSP90AA1 antibody. However we have seen positive staining in platelet nucleus. using this antibody. Is that expected? Could you tell me where is HSP90AA1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-10-24

Answer

From literature, platelet does express HSP90AA1. Generally HSP90AA1 expresses in nucleus. Regarding which tissues have HSP90AA1 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Heart, Pubmed ID: 2492519, 10409742
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 18318008, 24275569
Lymphoblast, Pubmed ID: 14654843
Melanoma, Pubmed ID: 17081065
Peripheral blood lymphocyte, Pubmed ID: 2780322
Pituitary, Pubmed ID: 16807684
Placenta, Pubmed ID: 2527334, 15489334
Placenta, and Teratocarcinoma, Pubmed ID: 14702039
Platelet, Pubmed ID: 18088087
Renal cell carcinoma, Pubmed ID: 10508479, 11274138
T-cell, Pubmed ID: 19367720

Boster Scientific Support

Answered: 2019-10-24

Question

Would anti-Hsp90 alpha/HSP90AA1 antibody PB9635 work for WB with brain?

Verified Customer

Verified customer

Asked: 2019-07-22

Answer

According to the expression profile of brain, HSP90AA1 is highly expressed in brain. So, it is likely that anti-Hsp90 alpha/HSP90AA1 antibody PB9635 will work for WB with brain.

Boster Scientific Support

Answered: 2019-07-22

Question

Here is the WB image, lot number and protocol we used for brain using anti-Hsp90 alpha/HSP90AA1 antibody PB9635. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-06-05

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-05

Question

Is this PB9635 anti-Hsp90 alpha/HSP90AA1 antibody reactive to the isotypes of HSP90AA1?

Verified Customer

Verified customer

Asked: 2018-10-02

Answer

The immunogen of PB9635 anti-Hsp90 alpha/HSP90AA1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN Q), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-10-02

Question

My lab would like using your anti-Hsp90 alpha/HSP90AA1 antibody for positive regulation of nitric oxide biosynthetic process studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2017-06-30

Answer

Thanks for your inquiry. This PB9635 anti-Hsp90 alpha/HSP90AA1 antibody is tested on rat liver tissue, brain tissue, tissue lysate, cardiac muscle tissue, hela whole cell lysate, jurkat whole cell lysate, 22rv1 whole cell lysate. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-06-30

Question

Is there a BSA free version of anti-Hsp90 alpha/HSP90AA1 antibody PB9635 available?

J. Parker

Verified customer

Asked: 2015-10-21

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Hsp90 alpha/HSP90AA1 antibody PB9635 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2015-10-21

Question

you antibody to test anti-Hsp90 alpha/HSP90AA1 antibody PB9635 on mouse brain for research purposes, then I may be interested in using anti-Hsp90 alpha/HSP90AA1 antibody PB9635 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

B. Huang

Verified customer

Asked: 2014-10-28

Answer

The products we sell, including anti-Hsp90 alpha/HSP90AA1 antibody PB9635, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2014-10-28

Question

We are currently using anti-Hsp90 alpha/HSP90AA1 antibody PB9635 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on pig tissues as well?

D. Li

Verified customer

Asked: 2014-03-25

Answer

The anti-Hsp90 alpha/HSP90AA1 antibody (PB9635) has not been validated for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2014-03-25

Question

Is a blocking peptide available for product anti-Hsp90 alpha/HSP90AA1 antibody (PB9635)?

B. Anderson

Verified customer

Asked: 2013-01-18

Answer

We do provide the blocking peptide for product anti-Hsp90 alpha/HSP90AA1 antibody (PB9635). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2013-01-18

Order DetailsPrice
PB9635

100μg

$370
PB9635-10ug

10μg sample (liquid)

$99
PB9635-Biotin

100 μg Biotin conjugated

$570
PB9635-Cy3

100 μg Cy3 conjugated

$570
PB9635-Dylight488

100 μg Dylight488 conjugated

$570
PB9635-Dylight550

100 μg Dylight550 conjugated

$570
PB9635-Dylight594

100 μg Dylight594 conjugated

$570
PB9635-FITC

100 μg FITC conjugated

$570
PB9635-HRP

100 μg HRP conjugated

$570
PB9635-APC

100 μg APC conjugated

$670
PB9635-PE

100 μg PE conjugated

$670
PB9635-iFluor647

100 μg iFluor647 conjugated

$670
PB9635-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9635
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.