Product Info Summary
SKU: | PB9635 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Monkey, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®
SKU/Catalog Number
PB9635
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband® catalog # PB9635. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9635)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9635 is reactive to HSP90AA1 in Human, Monkey, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
90 kDa
Calculated molecular weight
84660 MW
Background of HSP90AA1
Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9635 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: human Hela whole cell, human HEK293 whole cell, monkey COS-7 whole cell, human HepG2 whole cell, human A549 whole cell, rat PC-12 whole cell, rat RH35 whole cell, mouse HEPA1-6 whole cell
IHC: mouse testis tissue, rat testis tissue, human testis tissue
ICC/IF: U20S cell
FCM: SiHa cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (PB9635).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysate,
Lane 2: human HEK293 whole cell lysate,
Lane 3: monkey COS-7 whole cell lysate,
Lane 4: human HepG2 whole cell lysate,
Lane 5: human A549 whole cell lysate,
Lane 6: rat PC-12 whole cell lysate,
Lane 7: rat RH35 whole cell lysate,
Lane 8: mouse HEPA1-6 whole cell lysate.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Hsp90 alpha antigen affinity purified polyclonal antibody (Catalog # PB9635) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Hsp90 alpha at approximately 90 kDa. The expected band size for Hsp90 alpha is at 90 kDa.
Click image to see more details
Figure 2. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (PB9635).
Hsp90 alpha was detected in a paraffin-embedded section of mouse testis tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Hsp90 alpha Antibody (PB9635) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (PB9635).
Hsp90 alpha was detected in a paraffin-embedded section of rat testis tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Hsp90 alpha Antibody (PB9635) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (PB9635).
Hsp90 alpha was detected in a paraffin-embedded section of human testis tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Hsp90 alpha Antibody (PB9635) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IF analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (PB9635).
Hsp90 alpha was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-Hsp90 alpha Antibody (PB9635) overnight at 4°C. DyLight®550 Conjugated Goat Anti-Rabbit IgG (BA1135) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 6. Flow Cytometry analysis of SiHa cells using anti-Hsp90 alpha antibody (PB9635).
Overlay histogram showing SiHa cells stained with PB9635 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Hsp90 alpha Antibody (PB9635,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For HSP90AA1 (Source: Uniprot.org, NCBI)
Gene Name
HSP90AA1
Full Name
Heat shock protein HSP 90-alpha
Weight
84660 MW
Superfamily
heat shock protein 90 family
Alternative Names
Heat shock protein HSP 90-alpha;Heat shock 86 kDa;HSP 86;HSP86;Lipopolysaccharide-associated protein 2;LAP-2;LPS-associated protein 2;Renal carcinoma antigen NY-REN-38;HSP90AA1;HSP90A, HSPC1, HSPCA; HSP90AA1 EL52, HEL-S-65p, HSP86, HSP89A, HSP90A, HSP90N, HSPC1, HSPCA, HSPCAL1, HSPCAL4, HSPN, Hsp103, Hsp89, Hsp90, LAP-2, LAP2 heat shock protein 90 alpha family class A member 1 heat shock protein HSP 90-alpha|HSP 86|LPS-associated protein 2|epididymis luminal secretory protein 52|epididymis secretory sperm binding protein Li 65p|heat shock 86 kDa|heat shock 90kD protein 1, alpha|heat shock 90kD protein 1, alpha-like 4|heat shock 90kD protein, alpha-like 4|heat shock 90kDa protein 1, alpha|heat shock protein 90kDa alpha (cytosolic), class A member 1|heat shock protein 90kDa alpha family class A member 1|lipopolysaccharide-associated protein 2|renal carcinoma NY-REN-38
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on HSP90AA1, check out the HSP90AA1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HSP90AA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband® (PB9635)
Hello CJ!
PB9635 has been cited in 6 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Evaluation by different mechanisms of the protective effects of vitamin B12 on methotrexate nephrotoxicity
Thymoquinone attenuates doxorubicin‐cardiotoxicity in rats
Biaoxue Rong,Youwen Zhang,Junye Wang et al.Increased STIP1 and Hsp90 Correlate with Progression and Prognosis of Lung Adenocarcinoma,23 February 2021,PREPRINT (Version 1) available at Research Square [https://doi.org/10.21203/rs.3.rs-226260/v1]
Species: Human
PB9635 usage in article: APP:IHC, SAMPLE:LAC TISSUE, DILUTION:1:300
Youwen Zhang,Junye Wang,Shucheng Ye et al.Co-overexpression of STIP1 and Hsp90 correlates with progression and prognosis of lung adenocarcinoma,29 January 2020,PREPRINT (Version 2) available at Research Square [https://doi.org/10.21203/rs.2.13680/v2]
Species: Human
PB9635 usage in article: APP:IHC, SAMPLE:LAC TISSUE, DILUTION:1:300
The Effect of 5?-Adenylic Acid on Hepatic Proteome of Mice Radiated by 60Co ?-ray
Jiang Q, Wang Y, Li T, Shi K, Li Z, Ma Y, Li F, Luo H, Yang Y, Xu C. Mol Biol Cell. 2011 Apr 15;22(8):1167-80. Doi: 10.1091/Mbc.E10-10-0860. Epub 2011 Feb 23. Heat Shock Protein 90-Mediated Inactivation Of Nuclear Factor-??b Switches Autophagy To ...
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Hsp90 alpha/HSP90AA1 Antibody Picoband®
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-Hsp90 alpha/HSP90AA1 antibody PB9635. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-03-17
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-03-17
Question
Does PB9635 anti-Hsp90 alpha/HSP90AA1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-01-10
Answer
It shows on the product datasheet, PB9635 anti-Hsp90 alpha/HSP90AA1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-01-10
Question
We have been able to see staining in human lymphoblast. Are there any suggestions? Is anti-Hsp90 alpha/HSP90AA1 antibody supposed to stain lymphoblast positively?
Verified Customer
Verified customer
Asked: 2019-12-24
Answer
From literature lymphoblast does express HSP90AA1. From Uniprot.org, HSP90AA1 is expressed in middle temporal gyrus, peripheral blood lymphocyte, placenta, placenta teratocarcinoma, brain, cajal-retzius cell fetal brain cortex, heart, renal cell carcinoma, lymphoblast, cervix carcinoma, pituitary, t-cell, platelet, liver, leukemic t-cell, melanoma, cervix carcinoma erythroleukemia, among other tissues. Regarding which tissues have HSP90AA1 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Heart, Pubmed ID: 2492519, 10409742
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 18318008, 24275569
Lymphoblast, Pubmed ID: 14654843
Melanoma, Pubmed ID: 17081065
Peripheral blood lymphocyte, Pubmed ID: 2780322
Pituitary, Pubmed ID: 16807684
Placenta, Pubmed ID: 2527334, 15489334
Placenta, and Teratocarcinoma, Pubmed ID: 14702039
Platelet, Pubmed ID: 18088087
Renal cell carcinoma, Pubmed ID: 10508479, 11274138
T-cell, Pubmed ID: 19367720
Boster Scientific Support
Answered: 2019-12-24
Question
I was wanting to use your anti-Hsp90 alpha/HSP90AA1 antibody for WB for mouse brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse brain identification?
Verified Customer
Verified customer
Asked: 2019-12-17
Answer
You can see on the product datasheet, PB9635 anti-Hsp90 alpha/HSP90AA1 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-12-17
Question
My question regarding product PB9635, anti-Hsp90 alpha/HSP90AA1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-11-28
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9635 anti-Hsp90 alpha/HSP90AA1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-11-28
Question
I see that the anti-Hsp90 alpha/HSP90AA1 antibody PB9635 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-11-15
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-11-15
Question
We bought anti-Hsp90 alpha/HSP90AA1 antibody for WB on middle temporal gyrus last year. I am using human, and We intend to use the antibody for IHC next. I was wanting to use examining middle temporal gyrus as well as heart in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?
Verified Customer
Verified customer
Asked: 2019-11-11
Answer
I took a look at the website and datasheets of our anti-Hsp90 alpha/HSP90AA1 antibody and I see that PB9635 has been validated on human in both WB and IHC. Thus PB9635 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-11-11
Question
My boss were satisfied with the WB result of your anti-Hsp90 alpha/HSP90AA1 antibody. However we have seen positive staining in platelet nucleus. using this antibody. Is that expected? Could you tell me where is HSP90AA1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-10-24
Answer
From literature, platelet does express HSP90AA1. Generally HSP90AA1 expresses in nucleus. Regarding which tissues have HSP90AA1 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Heart, Pubmed ID: 2492519, 10409742
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 18318008, 24275569
Lymphoblast, Pubmed ID: 14654843
Melanoma, Pubmed ID: 17081065
Peripheral blood lymphocyte, Pubmed ID: 2780322
Pituitary, Pubmed ID: 16807684
Placenta, Pubmed ID: 2527334, 15489334
Placenta, and Teratocarcinoma, Pubmed ID: 14702039
Platelet, Pubmed ID: 18088087
Renal cell carcinoma, Pubmed ID: 10508479, 11274138
T-cell, Pubmed ID: 19367720
Boster Scientific Support
Answered: 2019-10-24
Question
Would anti-Hsp90 alpha/HSP90AA1 antibody PB9635 work for WB with brain?
Verified Customer
Verified customer
Asked: 2019-07-22
Answer
According to the expression profile of brain, HSP90AA1 is highly expressed in brain. So, it is likely that anti-Hsp90 alpha/HSP90AA1 antibody PB9635 will work for WB with brain.
Boster Scientific Support
Answered: 2019-07-22
Question
Here is the WB image, lot number and protocol we used for brain using anti-Hsp90 alpha/HSP90AA1 antibody PB9635. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-06-05
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-05
Question
Is this PB9635 anti-Hsp90 alpha/HSP90AA1 antibody reactive to the isotypes of HSP90AA1?
Verified Customer
Verified customer
Asked: 2018-10-02
Answer
The immunogen of PB9635 anti-Hsp90 alpha/HSP90AA1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN Q), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-10-02
Question
My lab would like using your anti-Hsp90 alpha/HSP90AA1 antibody for positive regulation of nitric oxide biosynthetic process studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2017-06-30
Answer
Thanks for your inquiry. This PB9635 anti-Hsp90 alpha/HSP90AA1 antibody is tested on rat liver tissue, brain tissue, tissue lysate, cardiac muscle tissue, hela whole cell lysate, jurkat whole cell lysate, 22rv1 whole cell lysate. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-06-30
Question
Is there a BSA free version of anti-Hsp90 alpha/HSP90AA1 antibody PB9635 available?
J. Parker
Verified customer
Asked: 2015-10-21
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Hsp90 alpha/HSP90AA1 antibody PB9635 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2015-10-21
Question
you antibody to test anti-Hsp90 alpha/HSP90AA1 antibody PB9635 on mouse brain for research purposes, then I may be interested in using anti-Hsp90 alpha/HSP90AA1 antibody PB9635 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
B. Huang
Verified customer
Asked: 2014-10-28
Answer
The products we sell, including anti-Hsp90 alpha/HSP90AA1 antibody PB9635, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2014-10-28
Question
We are currently using anti-Hsp90 alpha/HSP90AA1 antibody PB9635 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on pig tissues as well?
D. Li
Verified customer
Asked: 2014-03-25
Answer
The anti-Hsp90 alpha/HSP90AA1 antibody (PB9635) has not been validated for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2014-03-25
Question
Is a blocking peptide available for product anti-Hsp90 alpha/HSP90AA1 antibody (PB9635)?
B. Anderson
Verified customer
Asked: 2013-01-18
Answer
We do provide the blocking peptide for product anti-Hsp90 alpha/HSP90AA1 antibody (PB9635). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2013-01-18