Anti-Hsp90 alpha Antibody Picoband® (monoclonal, 6B5)

HSP90AA1 antibody

Boster Bio Anti-Hsp90 alpha Antibody Picoband® (monoclonal, 6B5) catalog # M01103-4. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: M01103-4
Size: 100 μg/vial
Reactive Species: Human, Monkey, Mouse, Rat
Host: Mouse
Application: Flow Cytometry, IF, IHC, ICC, WB

Product Name

Anti-Hsp90 alpha Antibody Picoband® (monoclonal, 6B5)

View all HSP90AA1 Antibodies

SKU/Catalog Number

M01103-4

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Hsp90 alpha Antibody Picoband® (monoclonal, 6B5) catalog # M01103-4. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Hsp90 alpha Antibody Picoband® (monoclonal, 6B5) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M01103-4)

Host

Mouse

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Clonality

Monoclonal

Clone Number

6B5

Isotype

Mouse IgG2b

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

M01103-4 is reactive to HSP90AA1 in Human, Monkey, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

90 kDa

Calculated molecular weight

84.66kDa

Background of HSP90AA1

Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

M01103-4 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.25-0.5μg/ml, Human, Mouse, Rat, Monkey
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human
Immunocytochemistry/Immunofluorescence, 5μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: human Hela whole cell, human HEK293 whole cell, monkey COS-7 whole cell, human HepG2 whole cell, human A549 whole cell, rat PC-12 whole cell, rat RH35 whole cell, mouse HEPA1-6 whole cell
IHC: human cervical cancer tissue, human colon cancer tissue, human lung cancer tissue, human testis cancer tissue
ICC/IF: SiHa cell
FCM: A549 cell

Validation Images & Assay Conditions

Gene/Protein Information For HSP90AA1 (Source: Uniprot.org, NCBI)

Gene Name

HSP90AA1

Full Name

Heat shock protein HSP 90-alpha

Weight

84.66kDa

Superfamily

heat shock protein 90 family

Alternative Names

Putative Polycomb group protein ASXL1; Additional sex combs-like protein 1; ASXL1; KIAA0978 HSP90AA1 EL52, HEL-S-65p, HSP86, HSP89A, HSP90A, HSP90N, HSPC1, HSPCA, HSPCAL1, HSPCAL4, HSPN, Hsp103, Hsp89, Hsp90, LAP-2, LAP2 heat shock protein 90 alpha family class A member 1 heat shock protein HSP 90-alpha|HSP 86|LPS-associated protein 2|epididymis luminal secretory protein 52|epididymis secretory sperm binding protein Li 65p|heat shock 86 kDa|heat shock 90kD protein 1, alpha|heat shock 90kD protein 1, alpha-like 4|heat shock 90kD protein, alpha-like 4|heat shock 90kDa protein 1, alpha|heat shock protein 90kDa alpha (cytosolic), class A member 1|heat shock protein 90kDa alpha family class A member 1|lipopolysaccharide-associated protein 2|renal carcinoma NY-REN-38

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on HSP90AA1, check out the HSP90AA1 Infographic

HSP90AA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HSP90AA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for M01103-4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Hsp90 alpha Antibody Picoband® (monoclonal, 6B5)?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Hsp90 alpha Antibody Picoband® (monoclonal, 6B5)

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-Hsp90 alpha Antibody Picoband® (monoclonal, 6B5)

Question

Would you please clarify the immunogen for Anti-Hsp90 Alpha Antibody Picoband™ (Monoclonal, 6B5) (M01103-4)?

Verified customer

Asked: 2022-03-17

Answer

The immunogen for this antibody is E.coli-derived human PTBP2 recombinant protein (Position: M1-A504), a synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ), identical to the related mouse and rat sequences.

Boster Scientific Support

Answered: 2022-03-17

Order DetailsPrice
M01103-4

100μg

$370
M01103-4-10ug

10μg sample (liquid)

$99
M01103-4-Biotin

100 μg Biotin conjugated

$570
M01103-4-Cy3

100 μg Cy3 conjugated

$570
M01103-4-Dylight488

100 μg Dylight488 conjugated

$570
M01103-4-Dylight550

100 μg Dylight550 conjugated

$570
M01103-4-Dylight594

100 μg Dylight594 conjugated

$570
M01103-4-FITC

100 μg FITC conjugated

$570
M01103-4-HRP

100 μg HRP conjugated

$570
M01103-4-APC

100 μg APC conjugated

$670
M01103-4-PE

100 μg PE conjugated

$670
M01103-4-iFluor647

100 μg iFluor647 conjugated

$670
M01103-4-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
M01103-4
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.