Click image to see more details
Product Info Summary
| SKU: | A30379 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Hepatitis B Virus Antibody Picoband®
SKU/Catalog Number
A30379
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Hepatitis B Virus Antibody Picoband® catalog # A30379. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Hepatitis B Virus Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A30379)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Hepatitis B Virus.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A30379 is reactive to S in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
6 kDa
Calculated molecular weight
6374 MW
Background of S
Hepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A30379 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, HBV
Positive Control
IHC: human hepatitis B tissue, human liver cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 2. IHC analysis of Hepatitis B Virus using anti-Hepatitis B Virus antibody (A30379). Hepatitis B Virus was detected in paraffin-embedded section of human hepatitis B tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Hepatitis B Virus Antibody (A30379) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 1. IHC analysis of Hepatitis B Virus using anti-Hepatitis B Virus antibody (A30379). Hepatitis B Virus was detected in paraffin-embedded section of human liver cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Hepatitis B Virus Antibody (A30379) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For S (Source: Uniprot.org, NCBI)
Gene Name
S
Full Name
Weight
6374 MW
Alternative Names
Large S protein ;S ;
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on S, check out the S Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for S: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Hepatitis B Virus Antibody Picoband® (A30379)
Hello CJ!
A30379 has been cited in 7 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
The presence and expression of the hepatitis B virus in human oocytes and embryos
TMEM2 inhibits hepatitis B virus infection in HepG2 and HepG2.2.15 cells by activating the JAK–STAT signaling pathway
Construction of a highly-active, liver-specific transcriptional regulatory element through combination of the albumin promoter and α-fetoprotein enhancer
Hepatitis B virus inhibition in mice by lentiviral vector mediated short hairpin RNA
Expression of transforming growth factor-? and hepatitis B surface antigen in human hepatocellular carcinoma tissues and its significance
Expression of transforming growth factor-? and hepatitis B surface antigen in human hepatocellular carcinoma tissues and its significance
Hepatitis B virus inhibition in mice by lentiviral vector mediated short hairpin RNA
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Hepatitis B Virus Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Hepatitis B Virus Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-Hepatitis B Virus Antibody Picoband®
Question
Is this A30379 anti-Hepatitis B Virus antibody reactive to the isotypes of S?
Verified Customer
Verified customer
Asked: 2020-03-16
Answer
The immunogen of A30379 anti-Hepatitis B Virus antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Hepatitis B Virus (4-51aa WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-16
Question
We are currently using anti-Hepatitis B Virus antibody A30379 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on monkey tissues as well?
Verified Customer
Verified customer
Asked: 2020-02-18
Answer
The anti-Hepatitis B Virus antibody (A30379) has not been tested for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-02-18
Question
Is a blocking peptide available for product anti-Hepatitis B Virus antibody (A30379)?
Verified Customer
Verified customer
Asked: 2018-04-27
Answer
We do provide the blocking peptide for product anti-Hepatitis B Virus antibody (A30379). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-04-27
Question
Can you help my question with product A30379, anti-Hepatitis B Virus antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
H. Singh
Verified customer
Asked: 2013-02-28
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A30379 anti-Hepatitis B Virus antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2013-02-28
