Click image to see more details
Product Info Summary
| SKU: | PB10068 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband®
View all Glucose 6 phosphate isomerase Antibodies
SKU/Catalog Number
PB10068
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband® catalog # PB10068. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10068)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GPI, different from the related mouse and rat sequences by sixteen amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB10068 is reactive to GPI in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
63 kDa
Calculated molecular weight
63147 MW
Background of Glucose 6 phosphate isomerase
Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase (PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB10068 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: human placenta tissue, JURKAT whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of GPI using anti-GPI antibody (PB10068).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human placenta tissue lysates，
Lane 2: JURKAT whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GPI antigen affinity purified polyclonal antibody (Catalog # PB10068) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for GPI at approximately 63 kDa. The expected band size for GPI is at 63 kDa.
Protein Target Info & Infographic
Gene/Protein Information For GPI (Source: Uniprot.org, NCBI)
Gene Name
GPI
Full Name
Glucose-6-phosphate isomerase
Weight
63147 MW
Superfamily
GPI family
Alternative Names
Glucose-6-phosphate isomerase;GPI;5.3.1.9;Autocrine motility factor;AMF;Neuroleukin;NLK;Phosphoglucose isomerase;PGI;Phosphohexose isomerase;PHI;Sperm antigen 36;SA-36;GPI; GPI AMF, GNPI, NLK, PGI, PHI, SA-36, SA36 glucose-6-phosphate isomerase glucose-6-phosphate isomerase|autocrine motility factor|hexose monophosphate isomerase|hexosephosphate isomerase|neuroleukin|oxoisomerase|phosphoglucose isomerase|phosphohexomutase|phosphohexose isomerase|phosphosaccharomutase|sperm -36
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on GPI, check out the GPI Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for GPI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband® (PB10068)
Hello CJ!
No publications found for PB10068
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband®
Question
My question regarding product PB10068, anti-Glucose 6 phosphate isomerase/GPI antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-04-14
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10068 anti-Glucose 6 phosphate isomerase/GPI antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-04-14
Question
Would PB10068 anti-Glucose 6 phosphate isomerase/GPI antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-03-06
Answer
As indicated on the product datasheet, PB10068 anti-Glucose 6 phosphate isomerase/GPI antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-03-06
Question
I see that the anti-Glucose 6 phosphate isomerase/GPI antibody PB10068 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-03-02
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-03-02
Question
Our lab want to know about using your anti-Glucose 6 phosphate isomerase/GPI antibody for neutrophil degranulation studies. Has this antibody been tested with western blotting on jurkat whole cell lysates? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-12-10
Answer
I appreciate your inquiry. This PB10068 anti-Glucose 6 phosphate isomerase/GPI antibody is tested on jurkat whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-12-10
Question
Is a blocking peptide available for product anti-Glucose 6 phosphate isomerase/GPI antibody (PB10068)?
Verified Customer
Verified customer
Asked: 2019-12-03
Answer
We do provide the blocking peptide for product anti-Glucose 6 phosphate isomerase/GPI antibody (PB10068). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-03
Question
We have observed staining in human amygdala. Do you have any suggestions? Is anti-Glucose 6 phosphate isomerase/GPI antibody supposed to stain amygdala positively?
Verified Customer
Verified customer
Asked: 2019-09-27
Answer
Based on literature amygdala does express GPI. Based on Uniprot.org, GPI is expressed in cerebellar vermis, testis, amygdala, skin, b-cell lymphoma, cervix carcinoma, leukemic t-cell, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have GPI expression, here are a few articles citing expression in various tissues:
Amygdala, Pubmed ID: 14702039
B-cell lymphoma, Pubmed ID: 3352745
Cervix carcinoma, Pubmed ID: 18669648
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Skin, Pubmed ID: 15489334
Testis, Pubmed ID: 10727272
Boster Scientific Support
Answered: 2019-09-27
Question
Is this PB10068 anti-Glucose 6 phosphate isomerase/GPI antibody reactive to the isotypes of GPI?
Verified Customer
Verified customer
Asked: 2019-08-16
Answer
The immunogen of PB10068 anti-Glucose 6 phosphate isomerase/GPI antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human GPI (5-39aa TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH), different from the related mouse and rat sequences by sixteen amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-08-16
Question
See attached the WB image, lot number and protocol we used for testis using anti-Glucose 6 phosphate isomerase/GPI antibody PB10068. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-08-05
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-05
Question
I was wanting to use your anti-Glucose 6 phosphate isomerase/GPI antibody for WB for human testis on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human testis identification?
Verified Customer
Verified customer
Asked: 2019-06-05
Answer
It shows on the product datasheet, PB10068 anti-Glucose 6 phosphate isomerase/GPI antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human testis in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-06-05
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for testis using anti-Glucose 6 phosphate isomerase/GPI antibody PB10068. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-05-21
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-05-21
Question
Would anti-Glucose 6 phosphate isomerase/GPI antibody PB10068 work for WB with testis?
Verified Customer
Verified customer
Asked: 2018-04-06
Answer
According to the expression profile of testis, GPI is highly expressed in testis. So, it is likely that anti-Glucose 6 phosphate isomerase/GPI antibody PB10068 will work for WB with testis.
Boster Scientific Support
Answered: 2018-04-06
Question
Our lab want to know about to test anti-Glucose 6 phosphate isomerase/GPI antibody PB10068 on human testis for research purposes, then I may be interested in using anti-Glucose 6 phosphate isomerase/GPI antibody PB10068 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-03-23
Answer
The products we sell, including anti-Glucose 6 phosphate isomerase/GPI antibody PB10068, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-03-23
Question
Our lab were content with the WB result of your anti-Glucose 6 phosphate isomerase/GPI antibody. However we have observed positive staining in b-cell lymphoma cytoplasm. using this antibody. Is that expected? Could you tell me where is GPI supposed to be expressed?
S. Evans
Verified customer
Asked: 2018-02-09
Answer
From what I have seen in literature, b-cell lymphoma does express GPI. Generally GPI expresses in cytoplasm. Regarding which tissues have GPI expression, here are a few articles citing expression in various tissues:
Amygdala, Pubmed ID: 14702039
B-cell lymphoma, Pubmed ID: 3352745
Cervix carcinoma, Pubmed ID: 18669648
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Skin, Pubmed ID: 15489334
Testis, Pubmed ID: 10727272
Boster Scientific Support
Answered: 2018-02-09
Question
Do you have a BSA free version of anti-Glucose 6 phosphate isomerase/GPI antibody PB10068 available?
Verified Customer
Verified customer
Asked: 2017-11-09
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Glucose 6 phosphate isomerase/GPI antibody PB10068 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-11-09
Question
We are currently using anti-Glucose 6 phosphate isomerase/GPI antibody PB10068 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on zebrafish tissues as well?
F. Baker
Verified customer
Asked: 2014-10-28
Answer
The anti-Glucose 6 phosphate isomerase/GPI antibody (PB10068) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2014-10-28
