Product Info Summary
SKU: | A04848-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | Flow Cytometry, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-GPCR LGR8/RXFP2 Antibody Picoband™
View all Relaxin R2/LGR8 Antibodies
SKU/Catalog Number
A04848-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-GPCR LGR8/RXFP2 Antibody Picoband™ catalog # A04848-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-GPCR LGR8/RXFP2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04848-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GPCR LGR8.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04848-1 is reactive to RXFP2 in Human
Applications
A04848-1 is guaranteed for Flow Cytometry, WB Boster Guarantee
Observed Molecular Weight
86 kDa
Calculated molecular weight
35883 MW
Background of Relaxin R2/LGR8
Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of GPCR LGR8 using anti-GPCR LGR8 antibody (A04848-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human SHG-44 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GPCR LGR8 antigen affinity purified polyclonal antibody (Catalog # A04848-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for GPCR LGR8 at approximately 86KD. The expected band size for GPCR LGR8 is at 86KD.
Click image to see more details
Figure 2. Flow Cytometry analysis of U251 cells using anti-GPCR LGR8 antibody (A04848-1).
Overlay histogram showing U251 cells stained with A04848-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-GPCR LGR8 Antibody (A04848-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For RXFP2 (Source: Uniprot.org, NCBI)
Gene Name
RXFP2
Full Name
Relaxin receptor 2
Weight
35883 MW
Superfamily
G-protein coupled receptor 1 family
Alternative Names
G protein coupled receptor affecting testicular descent; Gpr106; GPR106G-protein coupled receptor 106; Great; GREATRelaxin family peptide receptor 2; INSL3R; leucine-rich repeat-containing G protein-coupled receptor 8; Leucine-rich repeat-containing G-protein coupled receptor 8; Lgr8; LGR8.1; LGR8G-protein coupled receptor affecting testicular descent; Relaxin R2; relaxin receptor 2; relaxin/insulin-like family peptide receptor 2; RelaxinR2; RLN2R; Rxfp2; RXFPR2 RXFP2 GPR106, GREAT, INSL3R, LGR8, LGR8.1, RXFPR2 relaxin family peptide receptor 2 relaxin receptor 2|G protein coupled receptor affecting testicular descent|G-protein coupled receptor 106|leucine-rich repeat-containing G-protein coupled receptor 8|relaxin/insulin like family peptide receptor 2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on RXFP2, check out the RXFP2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for RXFP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-GPCR LGR8/RXFP2 Antibody Picoband™ (A04848-1)
Hello CJ!
No publications found for A04848-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-GPCR LGR8/RXFP2 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-GPCR LGR8/RXFP2 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
13 Customer Q&As for Anti-GPCR LGR8/RXFP2 Antibody Picoband™
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukocyte using anti-GPCR LGR8/RXFP2 antibody A04848-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-04-28
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-04-28
Question
Is this A04848-1 anti-GPCR LGR8/RXFP2 antibody reactive to the isotypes of RXFP2?
Verified Customer
Verified customer
Asked: 2019-11-11
Answer
The immunogen of A04848-1 anti-GPCR LGR8/RXFP2 antibody is A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-11-11
Question
I am interested in to test anti-GPCR LGR8/RXFP2 antibody A04848-1 on human leukocyte for research purposes, then I may be interested in using anti-GPCR LGR8/RXFP2 antibody A04848-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-11-06
Answer
The products we sell, including anti-GPCR LGR8/RXFP2 antibody A04848-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-11-06
Question
We are currently using anti-GPCR LGR8/RXFP2 antibody A04848-1 for human tissue, and we are satisfied with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on pig tissues as well?
Verified Customer
Verified customer
Asked: 2019-09-12
Answer
The anti-GPCR LGR8/RXFP2 antibody (A04848-1) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-09-12
Question
Do you have a BSA free version of anti-GPCR LGR8/RXFP2 antibody A04848-1 available?
Verified Customer
Verified customer
Asked: 2019-08-27
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-GPCR LGR8/RXFP2 antibody A04848-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-08-27
Question
I see that the anti-GPCR LGR8/RXFP2 antibody A04848-1 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-06-07
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-06-07
Question
Does anti-GPCR LGR8/RXFP2 antibody A04848-1 work on zebrafish Flow Cytometry with leukocyte?
Verified Customer
Verified customer
Asked: 2019-05-31
Answer
Our lab technicians have not tested anti-GPCR LGR8/RXFP2 antibody A04848-1 on zebrafish. You can run a BLAST between zebrafish and the immunogen sequence of anti-GPCR LGR8/RXFP2 antibody A04848-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated zebrafish samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in zebrafish leukocyte in Flow Cytometry, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-05-31
Question
I have a question about product A04848-1, anti-GPCR LGR8/RXFP2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-05-22
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04848-1 anti-GPCR LGR8/RXFP2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-05-22
Question
Please see the WB image, lot number and protocol we used for leukocyte using anti-GPCR LGR8/RXFP2 antibody A04848-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2017-09-22
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-09-22
Question
I was wanting to use your anti-GPCR LGR8/RXFP2 antibody for Flow Cytometry for human leukocyte on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human leukocyte identification?
D. Thomas
Verified customer
Asked: 2017-07-27
Answer
You can see on the product datasheet, A04848-1 anti-GPCR LGR8/RXFP2 antibody has been validated for Flow Cytometry, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human leukocyte in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-07-27
Question
Is a blocking peptide available for product anti-GPCR LGR8/RXFP2 antibody (A04848-1)?
Verified Customer
Verified customer
Asked: 2017-06-09
Answer
We do provide the blocking peptide for product anti-GPCR LGR8/RXFP2 antibody (A04848-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-06-09
Question
Will A04848-1 anti-GPCR LGR8/RXFP2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
W. Kulkarni
Verified customer
Asked: 2016-04-04
Answer
You can see on the product datasheet, A04848-1 anti-GPCR LGR8/RXFP2 antibody as been tested on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2016-04-04
Question
Will anti-GPCR LGR8/RXFP2 antibody A04848-1 work for Flow Cytometry with leukocyte?
L. Moore
Verified customer
Asked: 2014-07-29
Answer
According to the expression profile of leukocyte, RXFP2 is highly expressed in leukocyte. So, it is likely that anti-GPCR LGR8/RXFP2 antibody A04848-1 will work for Flow Cytometry with leukocyte.
Boster Scientific Support
Answered: 2014-07-29