Click image to see more details
Product Info Summary
| SKU: | A04681-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-GADD45G Antibody Picoband®
SKU/Catalog Number
A04681-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-GADD45G Antibody Picoband® catalog # A04681-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-GADD45G Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04681-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GADD45G, which shares 94.4% and 100% amino acid (aa) sequence identity with mouse and rat GADD45G, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04681-1 is reactive to GADD45G in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
19 kDa
Calculated molecular weight
17.121kDa
Background of GADD45G
Growth arrest and DNA-damage-inducible protein GADD45 gamma is a protein that in humans is encoded by the GADD45G gene on chromosome 9. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A04681-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot,0.1-0.5μg/ml
Positive Control
WB: rat brain tissue, rat heart tissue, rat testis tissue, rat skeletal muscle tissue, mouse brain tissue, mouse heart tissue, mouse testis tissue, mouse skeletal muscle tissue,,, human Hela whole cell, human placenta tissue, human SW620 whole cell, human A549 whole cell, mouse NIH3T3 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of GADD45G using anti-GADD45G antibody (A04681-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: rat heart tissue lysates,
Lane 3: rat testis tissue lysates,
Lane 4: rat skeletal muscle tissue lysates,
Lane 5: mouse brain tissue lysates,
Lane 6: mouse heart tissue lysates,
Lane 7: mouse testis tissue lysates,
Lane 8: mouse skeletal muscle tissue lysates,
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GADD45G antigen affinity purified polyclonal antibody (Catalog # A04681-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for GADD45G at approximately 19KD. The expected band size for GADD45G is at 17KD.
Click image to see more details
Figure 2. Western blot analysis of GADD45G using anti-GADD45G antibody (A04681-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human placenta tissue lysates,
Lane 3: human SW620 whole cell lysates,
Lane 4: human A549 whole cell lysates,
Lane 5: mouse NIH3T3 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GADD45G antigen affinity purified polyclonal antibody (Catalog # A04681-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for GADD45G at approximately 19KD. The expected band size for GADD45G is at 17KD.
Protein Target Info & Infographic
Gene/Protein Information For GADD45G (Source: Uniprot.org, NCBI)
Gene Name
GADD45G
Full Name
Growth arrest and DNA damage-inducible protein GADD45 gamma
Weight
17.121kDa
Superfamily
GADD45 family
Alternative Names
Growth arrest and DNA damage-inducible protein GADD45 gamma; Cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein; DDIT-2; GADD45G; CR6; DDIT2 GADD45G CR6, DDIT2, GADD45gamma, GRP17 growth arrest and DNA damage inducible gamma growth arrest and DNA damage-inducible protein GADD45 gamma|DDIT-2|DNA damage-inducible transcript 2 protein|GADD45-gamma|cytokine-responsive protein CR6|gadd-related protein, 17 kD
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on GADD45G, check out the GADD45G Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for GADD45G: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-GADD45G Antibody Picoband® (A04681-1)
Hello CJ!
No publications found for A04681-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-GADD45G Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-GADD45G Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
13 Customer Q&As for Anti-GADD45G Antibody Picoband®
Question
Is a blocking peptide available for product anti-GADD45G antibody (A04681-1)?
Verified Customer
Verified customer
Asked: 2019-12-19
Answer
We do provide the blocking peptide for product anti-GADD45G antibody (A04681-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-19
Question
Do you have a BSA free version of anti-GADD45G antibody A04681-1 available?
Verified Customer
Verified customer
Asked: 2019-10-25
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-GADD45G antibody A04681-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-10-25
Question
We are currently using anti-GADD45G antibody A04681-1 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on primate tissues as well?
Verified Customer
Verified customer
Asked: 2019-08-15
Answer
The anti-GADD45G antibody (A04681-1) has not been validated for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-15
Question
I was wanting to use your anti-GADD45G antibody for WB for human lung on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lung identification?
Verified Customer
Verified customer
Asked: 2019-05-13
Answer
It shows on the product datasheet, A04681-1 anti-GADD45G antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human lung in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-05-13
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-GADD45G antibody A04681-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-03-15
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-03-15
Question
My question regarding product A04681-1, anti-GADD45G antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-01-15
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04681-1 anti-GADD45G antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-01-15
Question
Here is the WB image, lot number and protocol we used for lung using anti-GADD45G antibody A04681-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-12-13
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-12-13
Question
Is this A04681-1 anti-GADD45G antibody reactive to the isotypes of GADD45G?
Verified Customer
Verified customer
Asked: 2018-12-07
Answer
The immunogen of A04681-1 anti-GADD45G antibody is A synthetic peptide corresponding to a sequence of human GADD45G (MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQ). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-12-07
Question
I am interested in to test anti-GADD45G antibody A04681-1 on human lung for research purposes, then I may be interested in using anti-GADD45G antibody A04681-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-12-05
Answer
The products we sell, including anti-GADD45G antibody A04681-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-12-05
Question
Would anti-GADD45G antibody A04681-1 work for WB with lung?
Verified Customer
Verified customer
Asked: 2018-10-04
Answer
According to the expression profile of lung, GADD45G is highly expressed in lung. So, it is likely that anti-GADD45G antibody A04681-1 will work for WB with lung.
Boster Scientific Support
Answered: 2018-10-04
Question
Will anti-GADD45G antibody A04681-1 work on dog WB with brain?
Verified Customer
Verified customer
Asked: 2018-08-24
Answer
Our lab technicians have not tested anti-GADD45G antibody A04681-1 on dog. You can run a BLAST between dog and the immunogen sequence of anti-GADD45G antibody A04681-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog brain in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-08-24
Question
Will A04681-1 anti-GADD45G antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
N. Krishna
Verified customer
Asked: 2017-10-02
Answer
As indicated on the product datasheet, A04681-1 anti-GADD45G antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-10-02
Question
I see that the anti-GADD45G antibody A04681-1 works with WB, what is the protocol used to produce the result images on the product page?
S. Li
Verified customer
Asked: 2016-08-10
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2016-08-10
