Click image to see more details
Product Info Summary
| SKU: | A00816-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Fibrinogen alpha chain/FGA Antibody Picoband®
SKU/Catalog Number
A00816-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Fibrinogen alpha chain/FGA Antibody Picoband® catalog # A00816-1. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Fibrinogen alpha chain/FGA Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00816-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human FGA, different from the related mouse and rat sequences by two amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00816-1 is reactive to FGA in Human, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
95 kDa
Calculated molecular weight
94973 MW
Background of FGA
Fibrinogen alpha chain is a protein that in humans is encoded by the FGA gene. This gene encodes the alpha subunit of the coagulation factor fibrinogen, which is a component of the blood clot. Following vascular injury, the encoded preproprotein is proteolytically processed by thrombin during the conversion of fibrinogen to fibrin. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00816-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Positive Control
WB: rat skeletal muscle tissue, HEPG2 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of FGA using anti-FGA antibody (A00816-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat skeletal muscle tissue lysates,
Lane 2: HEPG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-FGA antigen affinity purified polyclonal antibody (Catalog # A00816-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for FGA at approximately 95KD. The expected band size for FGA is at 95KD.
Protein Target Info & Infographic
Gene/Protein Information For FGA (Source: Uniprot.org, NCBI)
Gene Name
FGA
Full Name
Fibrinogen alpha chain
Weight
94973 MW
Alternative Names
Fibrinogen alpha chain;Fibrinopeptide A;Fibrinogen alpha chain;FGA; FGA Fib2 fibrinogen alpha chain fibrinogen alpha chain|fibrinogen, A alpha polypeptide
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on FGA, check out the FGA Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FGA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Fibrinogen alpha chain/FGA Antibody Picoband® (A00816-1)
Hello CJ!
No publications found for A00816-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Fibrinogen alpha chain/FGA Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Fibrinogen alpha chain/FGA Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Fibrinogen alpha chain/FGA Antibody Picoband®
Question
Is this A00816-1 anti-Fibrinogen alpha chain/FGA antibody reactive to the isotypes of FGA?
Verified Customer
Verified customer
Asked: 2020-03-18
Answer
The immunogen of A00816-1 anti-Fibrinogen alpha chain/FGA antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human FGA (687-727aa RTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVE), different from the related mouse and rat sequences by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-18
Question
My question regarding product A00816-1, anti-Fibrinogen alpha chain/FGA antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-03-10
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00816-1 anti-Fibrinogen alpha chain/FGA antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-03-10
Question
Do you have a BSA free version of anti-Fibrinogen alpha chain/FGA antibody A00816-1 available?
V. Carter
Verified customer
Asked: 2019-11-12
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Fibrinogen alpha chain/FGA antibody A00816-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-11-12
Question
We are currently using anti-Fibrinogen alpha chain/FGA antibody A00816-1 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2019-09-02
Answer
The anti-Fibrinogen alpha chain/FGA antibody (A00816-1) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-09-02
Question
I see that the anti-Fibrinogen alpha chain/FGA antibody A00816-1 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-05-23
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-05-23
Question
Will A00816-1 anti-Fibrinogen alpha chain/FGA antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-02-12
Answer
You can see on the product datasheet, A00816-1 anti-Fibrinogen alpha chain/FGA antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-02-12
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for pituitary using anti-Fibrinogen alpha chain/FGA antibody A00816-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2017-08-16
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-08-16
