Anti-Fibrinogen alpha chain/FGA Antibody Picoband®

FGA antibody

Boster Bio Anti-Fibrinogen alpha chain/FGA Antibody Picoband® catalog # A00816-1. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A00816-1
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-Fibrinogen alpha chain/FGA Antibody Picoband®

View all FGA Antibodies

SKU/Catalog Number

A00816-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Fibrinogen alpha chain/FGA Antibody Picoband® catalog # A00816-1. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Fibrinogen alpha chain/FGA Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00816-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human FGA, different from the related mouse and rat sequences by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00816-1 is reactive to FGA in Human, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

95 kDa

Calculated molecular weight

94973 MW

Background of FGA

Fibrinogen alpha chain is a protein that in humans is encoded by the FGA gene. This gene encodes the alpha subunit of the coagulation factor fibrinogen, which is a component of the blood clot. Following vascular injury, the encoded preproprotein is proteolytically processed by thrombin during the conversion of fibrinogen to fibrin. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00816-1 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat

Positive Control

WB: rat skeletal muscle tissue, HEPG2 whole cell

Validation Images & Assay Conditions

Gene/Protein Information For FGA (Source: Uniprot.org, NCBI)

Gene Name

FGA

Full Name

Fibrinogen alpha chain

Weight

94973 MW

Alternative Names

Fibrinogen alpha chain;Fibrinopeptide A;Fibrinogen alpha chain;FGA; FGA Fib2 fibrinogen alpha chain fibrinogen alpha chain|fibrinogen, A alpha polypeptide

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on FGA, check out the FGA Infographic

FGA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FGA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00816-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Fibrinogen alpha chain/FGA Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Fibrinogen alpha chain/FGA Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Fibrinogen alpha chain/FGA Antibody Picoband®

Question

Is this A00816-1 anti-Fibrinogen alpha chain/FGA antibody reactive to the isotypes of FGA?

Verified Customer

Verified customer

Asked: 2020-03-18

Answer

The immunogen of A00816-1 anti-Fibrinogen alpha chain/FGA antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human FGA (687-727aa RTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVE), different from the related mouse and rat sequences by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-03-18

Question

My question regarding product A00816-1, anti-Fibrinogen alpha chain/FGA antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-03-10

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00816-1 anti-Fibrinogen alpha chain/FGA antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-03-10

Question

Do you have a BSA free version of anti-Fibrinogen alpha chain/FGA antibody A00816-1 available?

V. Carter

Verified customer

Asked: 2019-11-12

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Fibrinogen alpha chain/FGA antibody A00816-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-11-12

Question

We are currently using anti-Fibrinogen alpha chain/FGA antibody A00816-1 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-02

Answer

The anti-Fibrinogen alpha chain/FGA antibody (A00816-1) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-02

Question

I see that the anti-Fibrinogen alpha chain/FGA antibody A00816-1 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-05-23

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-05-23

Question

Will A00816-1 anti-Fibrinogen alpha chain/FGA antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-02-12

Answer

You can see on the product datasheet, A00816-1 anti-Fibrinogen alpha chain/FGA antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-02-12

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for pituitary using anti-Fibrinogen alpha chain/FGA antibody A00816-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2017-08-16

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-08-16

Order DetailsPrice
A00816-1

100μg

$370
A00816-1-10ug

10μg sample (liquid)

$99
A00816-1-Biotin

100 μg Biotin conjugated

$570
A00816-1-Cy3

100 μg Cy3 conjugated

$570
A00816-1-Dylight488

100 μg Dylight488 conjugated

$570
A00816-1-Dylight550

100 μg Dylight550 conjugated

$570
A00816-1-Dylight594

100 μg Dylight594 conjugated

$570
A00816-1-FITC

100 μg FITC conjugated

$570
A00816-1-HRP

100 μg HRP conjugated

$570
A00816-1-APC

100 μg APC conjugated

$670
A00816-1-PE

100 μg PE conjugated

$670
A00816-1-iFluor647

100 μg iFluor647 conjugated

$670
A00816-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00816-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.