Click image to see more details
Product Info Summary
| SKU: | A13093-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | IF, IHC |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-FDCSP Antibody
SKU/Catalog Number
A13093-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-FDCSP Antibody catalog # A13093-1. Tested in IHC, IF applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-FDCSP Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A13093-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human FDCSP.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A13093-1 is reactive to FDCSP in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
28 kDa
Calculated molecular weight
9700 MW
Background of FDCSP
FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A13093-1 is guaranteed for IF, IHC Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunofluorescence, 5 μg/ml, Human
Positive Control
IHC: human tonsil tissue
IF: human tonsil tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. IHC analysis of FDCSP using anti-FDCSP antibody (A13093-1).
FDCSP was detected in paraffin-embedded section of human tonsil tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-FDCSP Antibody (A13093-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 2. IF analysis of FDCSP using anti-FDCSP antibody (A13093-1).
FDCSP was detected in a paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 μg/mL rabbit anti-FDCSP Antibody (A13093-1) overnight at 4°C. FITC Conjugated Goat Anti-Rabbit IgG (BA1105) was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For FDCSP (Source: Uniprot.org, NCBI)
Gene Name
FDCSP
Full Name
Follicular dendritic cell secreted peptide
Weight
9700 MW
Alternative Names
Follicular dendritic cell secreted peptide;FDC secreted protein;FDC-SP;FDCSP;C4orf7;UNQ733/PRO1419; FDCSP C4orf7, FDC-SP follicular dendritic cell secreted protein follicular dendritic cell secreted peptide|FDC secreted protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on FDCSP, check out the FDCSP Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FDCSP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-FDCSP Antibody (A13093-1)
Hello CJ!
A13093-1 has been cited in 2 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
C4orf7 contributes to ovarian cancer metastasis by promoting cancer cell migration and invasion
Development and characterization of a novel method for the analysis of gene expression patterns in lymphatic endothelial cells derived from primary breast tissues
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-FDCSP Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-FDCSP Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-FDCSP Antibody
Question
Will anti-FDCSP antibody A13093-1 work for IHC with minor salivary gland?
Verified Customer
Verified customer
Asked: 2020-02-03
Answer
According to the expression profile of minor salivary gland, FDCSP is highly expressed in minor salivary gland. So, it is likely that anti-FDCSP antibody A13093-1 will work for IHC with minor salivary gland.
Boster Scientific Support
Answered: 2020-02-03
Question
We are currently using anti-FDCSP antibody A13093-1 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2019-01-22
Answer
The anti-FDCSP antibody (A13093-1) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-01-22
Question
Is this A13093-1 anti-FDCSP antibody reactive to the isotypes of FDCSP?
Verified Customer
Verified customer
Asked: 2018-12-04
Answer
The immunogen of A13093-1 anti-FDCSP antibody is A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-12-04
Question
I was wanting to use to test anti-FDCSP antibody A13093-1 on human minor salivary gland for research purposes, then I may be interested in using anti-FDCSP antibody A13093-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-11-02
Answer
The products we sell, including anti-FDCSP antibody A13093-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-11-02
Question
My question regarding product A13093-1, anti-FDCSP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-09-24
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A13093-1 anti-FDCSP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-09-24
