Click image to see more details
Product Info Summary
| SKU: | A02900 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Exportin-5/XPO5 Antibody Picoband®
View all Exportin-5 Antibodies
SKU/Catalog Number
A02900
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Exportin-5/XPO5 Antibody Picoband® catalog # A02900. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Exportin-5/XPO5 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02900)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Exportin-5, different from the related mouse sequence by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02900 is reactive to XPO5 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
136 kDa
Calculated molecular weight
136311 MW
Background of Exportin-5
Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A02900 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: human Hela whole cell, human K562 whole cell, human HEL whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Exportin-5/XPO5 using anti-Exportin-5/XPO5 antibody (A02900).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human K562 whole cell lysates,
Lane 3: human HEL whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Exportin-5/XPO5 antigen affinity purified polyclonal antibody (Catalog # A02900) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Exportin-5/XPO5 at approximately 136 kDa. The expected band size for Exportin-5/XPO5 is at 136 kDa.
Protein Target Info & Infographic
Gene/Protein Information For XPO5 (Source: Uniprot.org, NCBI)
Gene Name
XPO5
Full Name
Exportin-5
Weight
136311 MW
Superfamily
exportin family
Alternative Names
Exportin-5;Exp5;Ran-binding protein 21;XPO5;KIAA1291, RANBP21; XPO5 exp5 exportin 5 exportin-5|ran-binding protein 21
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on XPO5, check out the XPO5 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for XPO5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Exportin-5/XPO5 Antibody Picoband® (A02900)
Hello CJ!
No publications found for A02900
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Exportin-5/XPO5 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Exportin-5/XPO5 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-Exportin-5/XPO5 Antibody Picoband®
Question
Is this A02900 anti-Exportin-5/XPO5 antibody reactive to the isotypes of XPO5?
Verified Customer
Verified customer
Asked: 2020-04-09
Answer
The immunogen of A02900 anti-Exportin-5/XPO5 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Exportin-5 (2-43aa AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK), different from the related mouse sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-09
Question
Here is the WB image, lot number and protocol we used for testis using anti-Exportin-5/XPO5 antibody A02900. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-02-17
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-17
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for testis using anti-Exportin-5/XPO5 antibody A02900. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-02-12
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-12
Question
Is a blocking peptide available for product anti-Exportin-5/XPO5 antibody (A02900)?
M. Johnson
Verified customer
Asked: 2019-02-15
Answer
We do provide the blocking peptide for product anti-Exportin-5/XPO5 antibody (A02900). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-02-15
Question
I was wanting to use to test anti-Exportin-5/XPO5 antibody A02900 on human testis for research purposes, then I may be interested in using anti-Exportin-5/XPO5 antibody A02900 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-09-12
Answer
The products we sell, including anti-Exportin-5/XPO5 antibody A02900, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-09-12
Question
We are currently using anti-Exportin-5/XPO5 antibody A02900 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?
H. Li
Verified customer
Asked: 2017-12-04
Answer
The anti-Exportin-5/XPO5 antibody (A02900) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-12-04
