Click image to see more details
Product Info Summary
| SKU: | A00010-2 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ErbB 2/ERBB2 Antibody Picoband®
View all ErbB2/Her2 Antibodies
SKU/Catalog Number
A00010-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ErbB 2/ERBB2 Antibody Picoband® catalog # A00010-2. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ErbB 2/ERBB2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00010-2)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A00010-2 is reactive to ERBB2 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
185 kDa
Calculated molecular weight
137910 MW
Background of ErbB2/Her2
Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00010-2 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: human Hela whole cell, human MCF-7 whole cell
IHC: human breast cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of ErbB 2 using anti-ErbB 2 antibody (A00010-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human MCF-7 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ErbB 2 antigen affinity purified polyclonal antibody (Catalog # A00010-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ErbB 2 at approximately 185 kDa. The expected band size for ErbB 2 is at 138 kDa.
Click image to see more details
Figure 2. IHC analysis of ErbB 2 using anti-ErbB 2 antibody (A00010-2).
ErbB 2 was detected in a paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-ErbB 2 Antibody (A00010-2) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For ERBB2 (Source: Uniprot.org, NCBI)
Gene Name
ERBB2
Full Name
Receptor tyrosine-protein kinase erbB-2
Weight
137910 MW
Superfamily
protein kinase superfamily
Alternative Names
Receptor tyrosine-protein kinase erbB-2;2.7.10.1;Metastatic lymph node gene 19 protein;MLN 19;Proto-oncogene Neu;Proto-oncogene c-ErbB-2;Tyrosine kinase-type cell surface receptor HER2;p185erbB2;CD340;ERBB2;HER2, MLN19, NEU, NGL; ERBB2 CD340, HER-2, HER-2/neu, HER2, MLN 19, NEU, NGL, TKR1 erb-b2 receptor tyrosine kinase 2 receptor tyrosine-protein kinase erbB-2|c-erb B2/neu protein|herstatin|human epidermal growth factor receptor 2|metastatic lymph node gene 19 protein|neuro/glioblastoma derived oncogene homolog|neuroblastoma/glioblastoma derived oncogene homolog|proto-oncogene Neu|proto-oncogene c-ErbB-2|tyrosine kinase-type cell surface receptor HER2|v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2|v-erb-b2 avian erythroblastic leukemia viral oncoprotein 2|v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ERBB2, check out the ERBB2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ERBB2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ErbB 2/ERBB2 Antibody Picoband® (A00010-2)
Hello CJ!
A00010-2 has been cited in 6 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
MiR199b Suppresses Expression of Hypoxia-Inducible Factor 1α (HIF-1α) in Prostate Cancer Cells
Lapatinib-incorporated lipoprotein-like nanoparticles: preparation and a proposed breast cancer-targeting mechanism
Incorporation of lapatinib into core–shell nanoparticles improves both the solubility and anti-glioma effects of the drug
Lapatinib-incorporated lipoprotein-like nanoparticles: preparation and a proposed breast cancer-targeting mechanism
Tong ZJ, Shi NY, Zhang ZJ, Yuan XD, Hong XM. Biosci Rep. 2017 Aug 2;37(4). pii: BSR20170121. doi: 10.1042/BSR20170121. Print 2017 Aug 31. Expression and prognostic value of HER-2/neu in primary breast cancer with sentinel lymph node metastasis
Tao L, Suhua C, Juanjuan C, Zongzhi Y, Juan X, Dandan Z. Virol J. 2011 Mar 11;8:114. Doi: 10.1186/1743-422X-8-114. In Vitro Study On Human Cytomegalovirus Affecting Early Pregnancy Villous Evt'S Invasion Function.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ErbB 2/ERBB2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-ErbB 2/ERBB2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-ErbB 2/ERBB2 Antibody Picoband®
Question
Does A00010-2 anti-ErbB 2/ERBB2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
V. Gonzalez
Verified customer
Asked: 2020-05-08
Answer
As indicated on the product datasheet, A00010-2 anti-ErbB 2/ERBB2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-05-08
Question
I am interested in using your anti-ErbB 2/ERBB2 antibody for positive regulation of cell adhesion studies. Has this antibody been tested with western blotting on hepg2 whole cell lysates? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2020-03-12
Answer
Thanks for your inquiry. This A00010-2 anti-ErbB 2/ERBB2 antibody is validated on hepg2 whole cell lysates. It is guaranteed to work for IHC, WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2020-03-12
Question
We have been able to see staining in rat fetal brain. Any tips? Is anti-ErbB 2/ERBB2 antibody supposed to stain fetal brain positively?
Verified Customer
Verified customer
Asked: 2020-02-28
Answer
Based on literature fetal brain does express ERBB2. Based on Uniprot.org, ERBB2 is expressed in esophagus mucosa, brain, fetal brain, mammary carcinoma, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have ERBB2 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Fetal brain, Pubmed ID: 24722188
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 2992089
Boster Scientific Support
Answered: 2020-02-28
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for fetal brain using anti-ErbB 2/ERBB2 antibody A00010-2. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-01-30
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-30
Question
you antibody to test anti-ErbB 2/ERBB2 antibody A00010-2 on human fetal brain for research purposes, then I may be interested in using anti-ErbB 2/ERBB2 antibody A00010-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-12-30
Answer
The products we sell, including anti-ErbB 2/ERBB2 antibody A00010-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-12-30
Question
Is this A00010-2 anti-ErbB 2/ERBB2 antibody reactive to the isotypes of ERBB2?
Verified Customer
Verified customer
Asked: 2019-07-17
Answer
The immunogen of A00010-2 anti-ErbB 2/ERBB2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2 (29-64aa TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-07-17
Question
I have a question about product A00010-2, anti-ErbB 2/ERBB2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-03-29
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00010-2 anti-ErbB 2/ERBB2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-03-29
Question
Do you have a BSA free version of anti-ErbB 2/ERBB2 antibody A00010-2 available?
M. Parker
Verified customer
Asked: 2019-03-12
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-ErbB 2/ERBB2 antibody A00010-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-03-12
Question
See attached the WB image, lot number and protocol we used for fetal brain using anti-ErbB 2/ERBB2 antibody A00010-2. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-01-25
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-01-25
Question
We ordered your anti-ErbB 2/ERBB2 antibody for IHC on cervix carcinoma a few years ago. I am using human, and We intend to use the antibody for WB next. We are interested in examining cervix carcinoma as well as mammary carcinoma in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?
Verified Customer
Verified customer
Asked: 2018-12-10
Answer
I viewed the website and datasheets of our anti-ErbB 2/ERBB2 antibody and I see that A00010-2 has been validated on human in both IHC and WB. Thus A00010-2 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2018-12-10
Question
We are currently using anti-ErbB 2/ERBB2 antibody A00010-2 for human tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on zebrafish tissues as well?
L. Brown
Verified customer
Asked: 2017-12-08
Answer
The anti-ErbB 2/ERBB2 antibody (A00010-2) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-12-08
Question
We were content with the WB result of your anti-ErbB 2/ERBB2 antibody. However we have been able to see positive staining in fetal brain isoform 1: cell membrane using this antibody. Is that expected? Could you tell me where is ERBB2 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2017-11-16
Answer
According to literature, fetal brain does express ERBB2. Generally ERBB2 expresses in isoform 1: cell membrane, isoform 2: cytoplasm. nucleus., isoform 3: cytoplasm. nucleus. Regarding which tissues have ERBB2 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Fetal brain, Pubmed ID: 24722188
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 2992089
Boster Scientific Support
Answered: 2017-11-16
Question
I was wanting to use your anti-ErbB 2/ERBB2 antibody for WB for human fetal brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human fetal brain identification?
S. Zhang
Verified customer
Asked: 2016-05-31
Answer
It shows on the product datasheet, A00010-2 anti-ErbB 2/ERBB2 antibody has been tested for IHC, WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human fetal brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2016-05-31
Question
I see that the anti-ErbB 2/ERBB2 antibody A00010-2 works with WB, what is the protocol used to produce the result images on the product page?
M. Singh
Verified customer
Asked: 2013-12-04
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2013-12-04
Question
Is a blocking peptide available for product anti-ErbB 2/ERBB2 antibody (A00010-2)?
D. Collins
Verified customer
Asked: 2013-08-28
Answer
We do provide the blocking peptide for product anti-ErbB 2/ERBB2 antibody (A00010-2). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2013-08-28
Question
Will anti-ErbB 2/ERBB2 antibody A00010-2 work for WB with fetal brain?
J. Mitchell
Verified customer
Asked: 2013-03-19
Answer
According to the expression profile of fetal brain, ERBB2 is highly expressed in fetal brain. So, it is likely that anti-ErbB 2/ERBB2 antibody A00010-2 will work for WB with fetal brain.
Boster Scientific Support
Answered: 2013-03-19
