Product Info Summary
SKU: | PB9698 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IF, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ELAVL4 Antibody Picoband®
SKU/Catalog Number
PB9698
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ELAVL4 Antibody Picoband® catalog # PB9698. Tested in IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ELAVL4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9698)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4, different from the related mouse and rat sequences by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9698 is reactive to ELAVL4 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
42 kDa
Calculated molecular weight
41770 MW
Background of ELAVL4
HuD otherwise known as ELAV-like protein 4 or PNEM is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is an RNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9698 is guaranteed for IF, IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunofluorescence, 2μg/ml, Human
Positive Control
WB: rat brain tissue, mouse brain tissue, U87-MG whole cell,
IHC: mouse brain tissue, rat brain tissue, human meningeoma tissue
IF: human glioma tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of ELAVL4 using anti-ELAVL4 antibody (PB9698).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: mouse brain tissue lysates,
Lane 3: U87-MG whole cell lysates,
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ELAVL4 antigen affinity purified polyclonal antibody (Catalog # PB9698) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ELAVL4 at approximately 42KD. The expected band size for ELAVL4 is at 42KD.
Click image to see more details
Figure 2. IHC analysis of ELAVL4 using anti-ELAVL4 antibody (PB9698).
ELAVL4 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ELAVL4 Antibody (PB9698) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen
Click image to see more details
Figure 3. IHC analysis of ELAVL4 using anti-ELAVL4 antibody (PB9698).
ELAVL4 was detected in paraffin-embedded section of rat brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ELAVL4 Antibody (PB9698) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen
Click image to see more details
Figure 4. IHC analysis of ELAVL4 using anti-ELAVL4 antibody (PB9698).
ELAVL4 was detected in paraffin-embedded section of human meningeoma tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ELAVL4 Antibody (PB9698) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IF analysis of ELAVL4 using anti-ELAVL4 antibody (PB9698)
ELAVL4 was detected in paraffin-embedded section of human glioma tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL rabbit anti-ELAVL4 Antibody (PB9698) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For ELAVL4 (Source: Uniprot.org, NCBI)
Gene Name
ELAVL4
Full Name
ELAV-like protein 4
Weight
41770 MW
Superfamily
RRM elav family
Alternative Names
ELAV-like protein 4;Hu-antigen D;HuD;Paraneoplastic encephalomyelitis antigen HuD;ELAVL4;HUD, PNEM; ELAVL4 HUD, PNEM ELAV like RNA binding protein 4 ELAV-like protein 4|ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu D)|ELAV like neuron-specific RNA binding protein 4|Hu D|paraneoplastic encephalomyelitis HuD
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ELAVL4, check out the ELAVL4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ELAVL4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ELAVL4 Antibody Picoband® (PB9698)
Hello CJ!
No publications found for PB9698
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ELAVL4 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-ELAVL4 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-ELAVL4 Antibody Picoband®
Question
Can the ratio/concentration of sodium azide in the lyophilized product PB9698 be determined?
Verified customer
Asked: 2020-06-22
Answer
Lyophilized Anti-ELAVL4 Antibody Picoband™ (PB9698) contains 0.3% sodium azide.
Boster Scientific Support
Answered: 2020-06-23
Question
I have a question about product PB9698, anti-ELAVL4 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-11-07
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9698 anti-ELAVL4 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-11-07
Question
We are currently using anti-ELAVL4 antibody PB9698 for mouse tissue, and we are content with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on zebrafish tissues as well?
R. Zhang
Verified customer
Asked: 2015-12-23
Answer
The anti-ELAVL4 antibody (PB9698) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2015-12-23
Question
Is this PB9698 anti-ELAVL4 antibody reactive to the isotypes of ELAVL4?
J. Huang
Verified customer
Asked: 2014-03-13
Answer
The immunogen of PB9698 anti-ELAVL4 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-03-13