Anti-ELAVL4 Antibody Picoband™

ELAVL4 antibody

Boster Bio Anti-ELAVL4 Antibody Picoband™ catalog # PB9698. Tested in IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9698
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-ELAVL4 Antibody Picoband™

View all ELAVL4 Antibodies

SKU/Catalog Number

PB9698

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ELAVL4 Antibody Picoband™ catalog # PB9698. Tested in IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ELAVL4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9698)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4, different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9698 is reactive to ELAVL4 in Human, Mouse, Rat

Applications

PB9698 is guaranteed for IF, IHC, WB Boster Guarantee

Observed Molecular Weight

42 kDa

Calculated molecular weight

41770 MW

Background of ELAVL4

HuD otherwise known as ELAV-like protein 4 or PNEM is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is an RNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunofluorescence, 2μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For ELAVL4 (Source: Uniprot.org, NCBI)

Gene Name

ELAVL4

Full Name

ELAV-like protein 4

Weight

41770 MW

Superfamily

RRM elav family

Alternative Names

abnormal vision, Drosophila, homolog of, like-4; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); HuD; Paraneoplastic encephalomyelitis antigen HuD ELAVL4 HUD, PNEM ELAV like RNA binding protein 4 ELAV-like protein 4|ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)|ELAV like neuron-specific RNA binding protein 4|Hu antigen D|paraneoplastic encephalomyelitis antigen HuD

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ELAVL4, check out the ELAVL4 Infographic

ELAVL4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ELAVL4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9698

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ELAVL4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-ELAVL4 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-ELAVL4 Antibody Picoband™

Question

Can the ratio/concentration of sodium azide in the lyophilized product PB9698 be determined?

Verified customer

Asked: 2020-06-22

Answer

Lyophilized Anti-ELAVL4 Antibody Picoband™ (PB9698) contains 0.3% sodium azide.

Boster Scientific Support

Answered: 2020-06-23

Question

I have a question about product PB9698, anti-ELAVL4 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-11-07

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9698 anti-ELAVL4 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-11-07

Question

We are currently using anti-ELAVL4 antibody PB9698 for mouse tissue, and we are content with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on zebrafish tissues as well?

R. Zhang

Verified customer

Asked: 2015-12-23

Answer

The anti-ELAVL4 antibody (PB9698) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2015-12-23

Question

Is this PB9698 anti-ELAVL4 antibody reactive to the isotypes of ELAVL4?

J. Huang

Verified customer

Asked: 2014-03-13

Answer

The immunogen of PB9698 anti-ELAVL4 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-03-13

Order DetailsPrice
PB9698

100μg

$370
PB9698-10ug

10μg sample (liquid)

$99
PB9698-Biotin

100 μg Biotin conjugated

$570
PB9698-Cy3

100 μg Cy3 conjugated

$570
PB9698-Dylight488

100 μg Dylight488 conjugated

$570
PB9698-Dylight550

100 μg Dylight550 conjugated

$570
PB9698-Dylight594

100 μg Dylight594 conjugated

$570
PB9698-FITC

100 μg FITC conjugated

$570
PB9698-HRP

100 μg HRP conjugated

$570
PB9698-APC

100 μg APC conjugated

$670
PB9698-PE

100 μg PE conjugated

$670
PB9698-iFluor647

100 μg iFluor647 conjugated

$670
PB9698-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9698
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.