Click image to see more details
Product Info Summary
| SKU: | PB9785 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | Flow Cytometry, IF, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CD45/PTPRC Antibody Picoband®
SKU/Catalog Number
PB9785
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CD45/PTPRC Antibody Picoband® catalog # PB9785. Tested in Flow Cytometry, IF, IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CD45/PTPRC Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9785)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CD45, different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9785 is reactive to PTPRC in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
180-250 kDa
Calculated molecular weight
147254 MW
Background of PTPRC
CD45 (Cluster of Differentiation 45), also known as PTPRC, LCA or CD45R, is an enzyme that, in humans, is encoded by the PTPRC gene. It is a member of the protein tyrosine phosphatase (PTP) family. CD45 is a major high molecular mass leukocyte cell surface molecule which is also an integral membrane protein tyrosine phosphatase. The cytogenetic location of CD45 is 1q31.3-q32.1. This gene is especially a prototype for transmembrane protein-tyrosine phosphatase (PTP). Targeted disruption of the CD45 gene leads to enhanced cytokine and interferon receptor-mediated activation of JAKs and STAT proteins. In vitro, CD45 directly dephosphorylates and binds to JAKs. Functionally, CD45 negatively regulates interleukin-3-mediated cellular proliferation, erythropoietin-dependent hematopoiesis, and antiviral responses in vitro and in vivo. In addition, CD45 has been best studied in T cells, where it determines T cell receptor signaling thresholds. CD45 is moved into or out of the immunological synapse (IS) membrane microdomain depending on the relative influence of interaction with the extracellular galectin lattice or the intracellular actin cytoskeleton. Galectin interaction can be finetuned by varying usage of the heavily Oglycosylated spliced regions and sialylation of Nlinked carbohydrates.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9785 is guaranteed for Flow Cytometry, IF, IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat
Immunofluorescence, 5μg/ml, Human
Flow Cytometry(Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: human Jurkat whole cell, human Raji whole cell
IHC: human tonsil tissue
IF: human tonsil tissue
FCM: Jurkat cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of CD45 using anti-CD45 antibody (PB9785).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Jurkat whole cell lysates,
Lane 2: human Raji whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CD45 antigen affinity purified polyclonal antibody (Catalog # PB9785) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CD45 at approximately 180-250 kDa. The expected band size for CD45 is at 147 kDa.
Click image to see more details
Figure 2. IHC analysis of CD45 using anti-CD45 antibody (PB9785).
CD45 was detected in a paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-CD45 Antibody (PB9785) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Figure 3. IF analysis of CD45 using anti-CD45 antibody (PB9785).
CD45 was detected in a paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 μg/mL rabbit anti-CD45 Antibody (PB9785) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 4. Flow Cytometry analysis of Jurkat cells using anti-CD45 antibody (PB9785).
Overlay histogram showing Jurkat cells stained with PB9785 (Blue line). The cells were fixed with 4% paraformaldehyde and blocked with 10% normal goat serum. And then incubated with rabbit anti-CD45 Antibody (PB9785, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For PTPRC (Source: Uniprot.org, NCBI)
Gene Name
PTPRC
Full Name
Receptor-type tyrosine-protein phosphatase C
Weight
147254 MW
Superfamily
protein-tyrosine phosphatase family
Alternative Names
Receptor-type tyrosine-protein phosphatase C;3.1.3.48;Leukocyte common antigen;L-CA;T200;CD45;PTPRC;CD45; PTPRC B220, CD45, CD45R, GP180, L-CA, LCA, LY5, T200 protein tyrosine phosphatase receptor type C receptor-type tyrosine-protein phosphatase C|CD45 |T200 glycoprotein|T200 leukocyte common |protein tyrosine phosphatase, receptor type, c polypeptide
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PTPRC, check out the PTPRC Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PTPRC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-CD45/PTPRC Antibody Picoband® (PB9785)
Hello CJ!
PB9785 has been cited in 6 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
CD11b deficiency suppresses intestinal tumor growth by reducing myeloid cell recruitment
Fas counterattack in cholangiocarcinoma: A mechanism for immune evasion in human hilar cholangiocarcinomas
Isolation and morphological characterization of ovine amniotic fluid mesenchymal stem cells
Huang Y, Jia X, Bai K, Gong X, Fan Y. Arch Med Res. 2010 Oct;41(7):497-505. Doi: 10.1016/J.Arcmed.2010.10.002. Effect Of Fluid Shear Stress On Cardiomyogenic Differentiation Of Rat Bone Marrow Mesenchymal Stem Cells.
Liu D, Wang Y, Ye Y, Yin G, Chen L. Cell Immunol. 2014 May-Jun;289(1-2):7-14. Doi: 10.1016/J.Cellimm.2014.01.007. Epub 2014 Feb 2. Distinct Molecular Basis For Endothelial Differentiation: Gene Expression Profiles Of Human Mesenchymal Stem Cells V...
Li X, Huang Y, Zheng L, Liu H, Niu X, Huang J, Zhao F, Fan Y. J Biomed Mater Res A. 2014 Apr;102(4):1092-101. Doi: 10.1002/Jbm.A.34774. Epub 2013 Jun 11. Effect Of Substrate Stiffness On The Functions Of Rat Bone Marrow And Adipose Tissue Derived ...
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CD45/PTPRC Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-CD45/PTPRC Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-CD45/PTPRC Antibody Picoband®
Question
Our lab want to know about using your anti-CD45/PTPRC antibody for leukocyte cell-cell adhesion studies. Has this antibody been tested with western blotting on jurkat whole cell lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2020-04-20
Answer
We appreciate your inquiry. This PB9785 anti-CD45/PTPRC antibody is tested on jurkat whole cell lysate, k562 whole cell lysate, human tonsil tissue. It is guaranteed to work for Flow Cytometry, IF, IHC-P, IHC-F, WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2020-04-20
Question
Is there a BSA free version of anti-CD45/PTPRC antibody PB9785 available?
J. Jones
Verified customer
Asked: 2020-03-31
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-CD45/PTPRC antibody PB9785 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-03-31
Question
We need to test anti-CD45/PTPRC antibody PB9785 on human t-cell for research purposes, then I may be interested in using anti-CD45/PTPRC antibody PB9785 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
K. Taylor
Verified customer
Asked: 2020-03-13
Answer
The products we sell, including anti-CD45/PTPRC antibody PB9785, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-03-13
Question
Will anti-CD45/PTPRC antibody PB9785 work for Flow Cytometry with t-cell?
Verified Customer
Verified customer
Asked: 2019-12-17
Answer
According to the expression profile of t-cell, PTPRC is highly expressed in t-cell. So, it is likely that anti-CD45/PTPRC antibody PB9785 will work for Flow Cytometry with t-cell.
Boster Scientific Support
Answered: 2019-12-17
Question
Does PB9785 anti-CD45/PTPRC antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-12-16
Answer
As indicated on the product datasheet, PB9785 anti-CD45/PTPRC antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-12-16
Question
Is this PB9785 anti-CD45/PTPRC antibody reactive to the isotypes of PTPRC?
Verified Customer
Verified customer
Asked: 2019-07-02
Answer
The immunogen of PB9785 anti-CD45/PTPRC antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human CD45(1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK), different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-07-02
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for t-cell using anti-CD45/PTPRC antibody PB9785. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-06-13
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-13
Question
We are currently using anti-CD45/PTPRC antibody PB9785 for human tissue, and we are content with the IHC-P results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on bovine tissues as well?
Verified Customer
Verified customer
Asked: 2019-06-10
Answer
The anti-CD45/PTPRC antibody (PB9785) has not been validated for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-06-10
Question
I was wanting to use your anti-CD45/PTPRC antibody for Flow Cytometry for human t-cell on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human t-cell identification?
Verified Customer
Verified customer
Asked: 2019-06-06
Answer
It shows on the product datasheet, PB9785 anti-CD45/PTPRC antibody has been validated for Flow Cytometry, IF, IHC-P, IHC-F, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human t-cell in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-06-06
Question
We have been able to see staining in human lymphocyte. Any tips? Is anti-CD45/PTPRC antibody supposed to stain lymphocyte positively?
Verified Customer
Verified customer
Asked: 2019-01-02
Answer
From what I have seen in literature lymphocyte does express PTPRC. From what I have seen in Uniprot.org, PTPRC is expressed in blood, lymphocyte, synovium, placenta, t-cell, liver, leukemic t-cell, erythroleukemia, among other tissues. Regarding which tissues have PTPRC expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19349973, 19690332
Liver, Pubmed ID: 19159218
Lymphocyte, Pubmed ID: 2824653
Placenta, Pubmed ID: 2971730, 2845400
Synovium, Pubmed ID: 14702039
T-cell, Pubmed ID: 19367720
Boster Scientific Support
Answered: 2019-01-02
Question
Please see the WB image, lot number and protocol we used for t-cell using anti-CD45/PTPRC antibody PB9785. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-10-05
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-10-05
Question
We have tried in the past anti-CD45/PTPRC antibody for IHC-P on leukemic t-cell in the past. I am using human, and We intend to use the antibody for IF next. My question regards examining leukemic t-cell as well as placenta in our next experiment. Could you please give me some suggestion on which antibody would work the best for IF?
Verified Customer
Verified customer
Asked: 2018-04-27
Answer
I looked at the website and datasheets of our anti-CD45/PTPRC antibody and it seems that PB9785 has been tested on human in both IHC-P and IF. Thus PB9785 should work for your application. Our Boster satisfaction guarantee will cover this product for IF in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IF detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2018-04-27
Question
My boss were satisfied with the WB result of your anti-CD45/PTPRC antibody. However we have been able to see positive staining in synovium cell membrane using this antibody. Is that expected? Could you tell me where is PTPRC supposed to be expressed?
Verified Customer
Verified customer
Asked: 2018-04-03
Answer
Based on literature, synovium does express PTPRC. Generally PTPRC expresses in cell membrane. Regarding which tissues have PTPRC expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19349973, 19690332
Liver, Pubmed ID: 19159218
Lymphocyte, Pubmed ID: 2824653
Placenta, Pubmed ID: 2971730, 2845400
Synovium, Pubmed ID: 14702039
T-cell, Pubmed ID: 19367720
Boster Scientific Support
Answered: 2018-04-03
Question
Can you help my question with product PB9785, anti-CD45/PTPRC antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2017-06-22
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9785 anti-CD45/PTPRC antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-06-22
Question
I see that the anti-CD45/PTPRC antibody PB9785 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
R. Li
Verified customer
Asked: 2016-11-28
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2016-11-28
Question
Is a blocking peptide available for product anti-CD45/PTPRC antibody (PB9785)?
O. Williams
Verified customer
Asked: 2016-07-27
Answer
We do provide the blocking peptide for product anti-CD45/PTPRC antibody (PB9785). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2016-07-27
