Product Info Summary
SKU: | PB9686 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-B3GNT8 Antibody Picoband™
SKU/Catalog Number
PB9686
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-B3GNT8 Antibody Picoband™ catalog # PB9686. Tested in IHC, WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-B3GNT8 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9686)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8, different from the related mouse sequence by sixteen amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9686 is reactive to B3gnt8 in Human
Applications
PB9686 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
43 kDa
Calculated molecular weight
43396 MW
Background of B3gnt8
B3GNT8 is a galactosyltransferase involved in the synthesis of poly-N-acetyllactosamine (polyLacNAc), a linear chain of repeating LacNAc units made up of galactose (Gal) and N-acetylglucosamine (GlcNAc) with the structure (Gal-beta-1-4-GlcNAc-beta-1-3)n. By genomic sequence analysis, the B3GNT8 gene is mapped to chromosome 19q13.2. It was showed that a soluble form of B3GNT8 overexpressed by transfected HEK293 cells selectively transferred GlcNAc from UDP-GlcNAc to the nonreducing terminus of Gal-beta-1-4-GlcNAc-alpha-p-nitrophenyl phosphate and to lactoside-alpha-benzoyl. It did not utilize keratan sulfates or polylactosamine oligosaccharide as substrate. B3GNT8 activity required Mn (2+) and showed less efficiency with Co (2+). The pH optimum was between 7 and 7.5. B3GNT8 also transferred GlcNAc onto alpha-1-acid glycoprotein and ovomucoid, which possess tetraantennary complex type and pentaantennary complex type N-glycans. With a tetraantennary N-glycan substrate, B3GNT8 appeared to prefer the beta-1-2 branch over the beta-1-6 branch. When overexpressed in HCT15 human colon cancer cells, B3GNT8 increased cell surface expression of both polyLacNAc and beta-1-6-branched N-glycans.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human
Validation Images & Assay Conditions
![pb9686 1 WB anti b3gnt8 picoband antibody pb9686 1 WB anti b3gnt8 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9686-1-WB-anti-b3gnt8-picoband-antibody.jpg)
Click image to see more details
Figure 1. Western blot analysis of B3GNT8 using anti-B3GNT8 antibody (PB9686).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: HELA Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-B3GNT8 antigen affinity purified polyclonal antibody (Catalog # PB9686) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for B3GNT8 at approximately 43 kDa. The expected band size for B3GNT8 is at 43 kDa.
![pb9686 2 IHC anti b3gnt8 picoband antibody pb9686 2 IHC anti b3gnt8 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9686-2-IHC-anti-b3gnt8-picoband-antibody.jpg)
Click image to see more details
Figure 2. IHC analysis of B3GNT8 using anti-B3GNT8 antibody (PB9686).
B3GNT8 was detected in a paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-B3GNT8 Antibody (PB9686) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For B3gnt8 (Source: Uniprot.org, NCBI)
Gene Name
B3gnt8
Full Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
Weight
43396 MW
Superfamily
glycosyltransferase 31 family
Alternative Names
B3GALT7; Beta Galactosyltransferase BGALT15; beta-1,3-Gn-T8; beta-1,3-N-acetylglucosaminyltransferase 8; Beta1,3-N-Acetylglucosaminyltransferase 8; beta3Gn-T8; BGALT15; BGnT-8; EC 2.4.1.-; UDP-Gal:BetaGal Beta 1,3-Galactosyltransferase Polypeptide 7; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on B3gnt8, check out the B3gnt8 Infographic
![B3gnt8 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for B3gnt8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-B3GNT8 Antibody Picoband™ (PB9686)
Hello CJ!
No publications found for PB9686
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-B3GNT8 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-B3GNT8 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-B3GNT8 Antibody Picoband™
Question
My question regarding product PB9686, anti-B3GNT8 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
L. Li
Verified customer
Asked: 2020-02-03
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9686 anti-B3GNT8 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-02-03
Question
We are currently using anti-B3GNT8 antibody PB9686 for human tissue, and we are well pleased with the IHC results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-29
Answer
The anti-B3GNT8 antibody (PB9686) has not been tested for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-29
Question
Would PB9686 anti-B3GNT8 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-11-07
Answer
It shows on the product datasheet, PB9686 anti-B3GNT8 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-11-07
Question
Is a blocking peptide available for product anti-B3GNT8 antibody (PB9686)?
Verified Customer
Verified customer
Asked: 2018-12-17
Answer
We do provide the blocking peptide for product anti-B3GNT8 antibody (PB9686). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-12-17
Question
Is this PB9686 anti-B3GNT8 antibody reactive to the isotypes of B3GNT8?
Verified Customer
Verified customer
Asked: 2018-08-02
Answer
The immunogen of PB9686 anti-B3GNT8 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-08-02
Question
I see that the anti-B3GNT8 antibody PB9686 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-06-25
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-06-25
Question
I was wanting to use your anti-B3GNT8 antibody for IHC for human lower esophagus mucosa on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lower esophagus mucosa identification?
Verified Customer
Verified customer
Asked: 2017-12-25
Answer
You can see on the product datasheet, PB9686 anti-B3GNT8 antibody has been tested for IHC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human lower esophagus mucosa in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-12-25