Product Info Summary
SKU: | A00655 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ATF6 Antibody Picoband™
SKU/Catalog Number
A00655
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ATF6 Antibody Picoband™ catalog # A00655. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ATF6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00655)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6, different from the related mouse and rat sequences by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A00655 is reactive to ATF6 in Human, Mouse, Rat
Applications
A00655 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
90 kDa, 100 kDa
Calculated molecular weight
74585 MW
Background of ATF6
ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE).
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Validation Images & Assay Conditions
![a00655 2 IHC anti atf6 picoband antibody a00655 2 IHC anti atf6 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/a00655-2-IHC-anti-atf6-picoband-antibody.jpg)
Click image to see more details
Figure 2. IHC analysis of ATF6 using anti-ATF6 antibody (A00655).
ATF6 was detected in paraffin-embedded section of human mammary cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ATF6 Antibody (A00655) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
![a00655 1 WB anti atf6 picoband antibody a00655 1 WB anti atf6 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/a00655-1-WB-anti-atf6-picoband-antibody.jpg)
Click image to see more details
Figure 1. Western blot analysis of ATF6 using anti-ATF6 antibody (A00655).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat liver tissue lysates,
Lane 2: mouse liver tissue lysates,
Lane 3: MCF-7 whole Cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ATF6 antigen affinity purified polyclonal antibody (Catalog # A00655) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ATF6 at approximately 90 KD,100KD. The expected band size for ATF6 is at 75KD.
Protein Target Info & Infographic
Gene/Protein Information For ATF6 (Source: Uniprot.org, NCBI)
Gene Name
ATF6
Full Name
Cyclic AMP-dependent transcription factor ATF-6 alpha
Weight
74585 MW
Superfamily
bZIP family
Alternative Names
ACHM7; Activating transcription factor 6 alpha; activating transcription factor 6; atf6 a; ATF6 alpha; ATF6; ATF6A; ATF6-alpha; cAMP-dependent transcription factor ATF-6 alpha; cyclic AMP-dependent transcription factor ATF-6 alpha ATF6 ACHM7A, ATF6 activating transcription factor 6 cyclic AMP-dependent transcription factor ATF-6 alpha|cAMP-dependent transcription factor ATF-6 alpha
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ATF6, check out the ATF6 Infographic
![ATF6 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ATF6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ATF6 Antibody Picoband™ (A00655)
Hello CJ!
A00655 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
GSH-Independent Induction of ER Stress during Hypoglycaemia in the Retinal Cells of Mice
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ATF6 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-ATF6 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
17 Customer Q&As for Anti-ATF6 Antibody Picoband™
Question
I was wanting to use your anti-ATF6 antibody for WB for mouse corpus epididymis on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse corpus epididymis identification?
Verified Customer
Verified customer
Asked: 2020-05-08
Answer
As indicated on the product datasheet, A00655 anti-ATF6 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse corpus epididymis in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-05-08
Question
I am interested in to test anti-ATF6 antibody A00655 on mouse corpus epididymis for research purposes, then I may be interested in using anti-ATF6 antibody A00655 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-04-24
Answer
The products we sell, including anti-ATF6 antibody A00655, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-04-24
Question
We have observed staining in human cervix carcinoma. Any tips? Is anti-ATF6 antibody supposed to stain cervix carcinoma positively?
J. Bhatt
Verified customer
Asked: 2020-03-05
Answer
From literature cervix carcinoma does express ATF6. From Uniprot.org, ATF6 is expressed in corpus epididymis, cervix carcinoma, pancreas, among other tissues. Regarding which tissues have ATF6 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 9271374, 9837962
Pancreas, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2020-03-05
Question
We have tried in the past anti-ATF6 antibody for IHC on pancreas a few years ago. I am using rat, and We intend to use the antibody for WB next. you antibody examining pancreas as well as corpus epididymis in our next experiment. Do you have any suggestion on which antibody would work the best for WB?
Verified Customer
Verified customer
Asked: 2019-12-11
Answer
I looked at the website and datasheets of our anti-ATF6 antibody and I see that A00655 has been tested on rat in both IHC and WB. Thus A00655 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-12-11
Question
Does A00655 anti-ATF6 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-06-13
Answer
It shows on the product datasheet, A00655 anti-ATF6 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-06-13
Question
My colleagues were well pleased with the WB result of your anti-ATF6 antibody. However we have been able to see positive staining in pancreas endoplasmic reticulum membrane using this antibody. Is that expected? Could you tell me where is ATF6 supposed to be expressed?
K. Miller
Verified customer
Asked: 2018-10-31
Answer
From literature, pancreas does express ATF6. Generally ATF6 expresses in endoplasmic reticulum membrane. Regarding which tissues have ATF6 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 9271374, 9837962
Pancreas, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2018-10-31
Question
Will anti-ATF6 antibody A00655 work for WB with corpus epididymis?
C. Thomas
Verified customer
Asked: 2018-08-30
Answer
According to the expression profile of corpus epididymis, ATF6 is highly expressed in corpus epididymis. So, it is likely that anti-ATF6 antibody A00655 will work for WB with corpus epididymis.
Boster Scientific Support
Answered: 2018-08-30
Question
Is this A00655 anti-ATF6 antibody reactive to the isotypes of ATF6?
Verified Customer
Verified customer
Asked: 2018-08-13
Answer
The immunogen of A00655 anti-ATF6 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-08-13
Question
Does anti-ATF6 antibody A00655 work on horse IHC with corpus epididymis?
Verified Customer
Verified customer
Asked: 2018-02-13
Answer
Our lab technicians have not validated anti-ATF6 antibody A00655 on horse. You can run a BLAST between horse and the immunogen sequence of anti-ATF6 antibody A00655 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse corpus epididymis in IHC, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-02-13
Question
I see that the anti-ATF6 antibody A00655 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-02-08
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-02-08
Question
See attached the WB image, lot number and protocol we used for corpus epididymis using anti-ATF6 antibody A00655. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-01-29
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-01-29
Question
Is there a BSA free version of anti-ATF6 antibody A00655 available?
Verified Customer
Verified customer
Asked: 2017-10-09
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-ATF6 antibody A00655 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-10-09
Question
Is a blocking peptide available for product anti-ATF6 antibody (A00655)?
Verified Customer
Verified customer
Asked: 2017-08-17
Answer
We do provide the blocking peptide for product anti-ATF6 antibody (A00655). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-08-17
Question
I am looking for using your anti-ATF6 antibody for regulation of transcription by rna polymerase ii studies. Has this antibody been tested with western blotting on mouse liver tissue? We would like to see some validation images before ordering.
D. Mangal
Verified customer
Asked: 2016-12-23
Answer
I appreciate your inquiry. This A00655 anti-ATF6 antibody is validated on rat liver tissue, mouse liver tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2016-12-23
Question
Can you help my question with product A00655, anti-ATF6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
R. Moore
Verified customer
Asked: 2016-12-02
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00655 anti-ATF6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2016-12-02
Question
We are currently using anti-ATF6 antibody A00655 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on monkey tissues as well?
M. Collins
Verified customer
Asked: 2014-03-10
Answer
The anti-ATF6 antibody (A00655) has not been tested for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2014-03-10
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for corpus epididymis using anti-ATF6 antibody A00655. Let me know if you need anything else.
O. Taylor
Verified customer
Asked: 2013-09-23
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2013-09-23