AMSH (STAMBP) (NM_201647) Human Recombinant Protein

AMSH/STAMBP protein,

Product Info Summary

SKU: PROTO95630
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

AMSH (STAMBP) (NM_201647) Human Recombinant Protein

View all AMSH/STAMBP recombinant proteins

SKU/Catalog Number

PROTO95630

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human STAM binding protein (STAMBP), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

AMSH (STAMBP) (NM_201647) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95630)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

47.9 kDa

Amino Acid Sequence

MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR

Validation Images & Assay Conditions

Gene/Protein Information For STAMBP (Source: Uniprot.org, NCBI)

Gene Name

STAMBP

Full Name

STAM-binding protein

Weight

47.9 kDa

Superfamily

peptidase M67C family

Alternative Names

AMSH; AMSHAssociated molecule with the SH3 domain of STAM; EC 3.1.2.15; EC 3.4.19.-; Endosome-associated ubiquitin isopeptidase; MGC126516; MGC126518; STAM binding protein; STAM-binding protein; STAMBP STAMBP AMSH, MICCAP STAM binding protein STAM-binding protein|associated molecule with the SH3 domain of STAM|endosome-associated ubiquitin isopeptidase|testicular secretory protein Li 54

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on STAMBP, check out the STAMBP Infographic

STAMBP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for STAMBP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95630

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used AMSH (STAMBP) (NM_201647) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For AMSH (STAMBP) (NM_201647) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for AMSH (STAMBP) (NM_201647) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95630
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.